KEGG   Rousettus aegyptiacus (Egyptian rousette): 107502868
Entry
107502868         CDS       T06036                                 

Gene name
TPM2
Definition
(RefSeq) tropomyosin beta chain isoform X1
  KO
K10374  tropomyosin 2
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04260  Cardiac muscle contraction
ray04261  Adrenergic signaling in cardiomyocytes
ray05410  Hypertrophic cardiomyopathy
ray05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:ray00001]
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    107502868 (TPM2)
   04261 Adrenergic signaling in cardiomyocytes
    107502868 (TPM2)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    107502868 (TPM2)
   05414 Dilated cardiomyopathy
    107502868 (TPM2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:ray04812]
    107502868 (TPM2)
Cytoskeleton proteins [BR:ray04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Tropomyosins
     107502868 (TPM2)
SSDB
Motif
Pfam: Tropomyosin Tropomyosin_1 CLZ ERM TMF_DNA_bd Laminin_II DUF3450 Cluap1 ADIP Snapin_Pallidin ATG16 DASH_Duo1 Suppressor_APC DUF745 XhlA Fib_alpha
Other DBs
NCBI-GeneID: 107502868
NCBI-ProteinID: XP_015986022
LinkDB
Position
Unknown
AA seq 284 aa
MDAIKKKMQMLKLDKENAIDRAEQAEADKKQAEDRCKQLEEEQQALQKKLKGTEDEVEKY
SESVKDAQEKLELAEKKATDAEADVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAA
DESERGMKVIENRAMKDEEKMELQEMQLKEAKHIAEDSDRKYEEVARKLVILEGELERSE
ERAEVAESRARQLEEELRTMDQALKSLMASEEEYSTKEDKYEEEIKLLEEKLKEAETRAE
FAERSVAKLEKTIDDLEETLASAKEENVEIHQTLDQTLLELNNL
NT seq 855 nt   +upstreamnt  +downstreamnt
atggacgccatcaagaagaagatgcagatgctaaaactggacaaggagaatgccatcgac
cgcgctgagcaggccgaggctgacaagaagcaagctgaggaccgctgcaagcagctggag
gaggaacagcaggccctccagaagaagctgaaaggaacagaggatgaggtggaaaagtat
tctgagtcagtgaaggacgcccaggagaaactggagctggccgagaagaaagccaccgac
gccgaggcagatgtggcctccctgaaccgccgcattcagctggtagaggaggagctggac
cgggcgcaggagcgcctggctacagccctgcaaaagctggaggaggctgagaaagcagct
gatgagagcgagagaggaatgaaggtcattgaaaaccgagccatgaaggatgaggaaaag
atggagcttcaagagatgcagctgaaggaggccaagcacatcgctgaggattcagaccga
aaatatgaggaggtggccaggaagctggtgatcctggaaggagagctggagcgctcagaa
gagagagctgaggtggctgagagccgagcaaggcaactggaggaggaacttcgaaccatg
gaccaggccctcaagtccctgatggcctcagaggaggagtattccaccaaagaagataaa
tatgaagaggagatcaaactgctggaggagaagctgaaggaggctgagacccgagcagag
tttgccgaaaggtctgtggcaaagttggagaaaaccattgatgacctggaagagaccttg
gccagtgccaaggaagagaatgtggagattcaccagaccctcgaccagaccctactggaa
ctcaacaacctgtga

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107508997
Entry
107508997         CDS       T06036                                 

Gene name
TPM1
Definition
(RefSeq) tropomyosin alpha-1 chain isoform X1
  KO
K10373  tropomyosin 1
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04260  Cardiac muscle contraction
ray04261  Adrenergic signaling in cardiomyocytes
ray05206  MicroRNAs in cancer
ray05410  Hypertrophic cardiomyopathy
ray05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:ray00001]
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    107508997 (TPM1)
   04261 Adrenergic signaling in cardiomyocytes
    107508997 (TPM1)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    107508997 (TPM1)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    107508997 (TPM1)
   05414 Dilated cardiomyopathy
    107508997 (TPM1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:ray04812]
    107508997 (TPM1)
   04147 Exosome [BR:ray04147]
    107508997 (TPM1)
Cytoskeleton proteins [BR:ray04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Tropomyosins
     107508997 (TPM1)
Exosome [BR:ray04147]
 Exosomal proteins
  Exosomal proteins of microglial cells
   107508997 (TPM1)
SSDB
Motif
Pfam: Tropomyosin Tropomyosin_1 CLZ Laminin_II TMF_DNA_bd Crescentin Laminin_I ERM ADIP CENP-F_leu_zip DUF3450 DUF745 AAA_13 DUF1664 ATG16 DUF16 Fib_alpha Lebercilin MAD XhlA
Other DBs
NCBI-GeneID: 107508997
NCBI-ProteinID: XP_015996604
LinkDB
Position
Unknown
AA seq 284 aa
MDAIKKKMQMLKLDKENALDRAEQAEADKKAAEDRSKQLEDELVSLQKKLKGTEDELDKY
SEALKDAQEKLELAEKKATDAEADVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAA
DESERGMKVIESRAQKDEEKMEIQEIQLKEAKHIAEDADRKYEEVARKLVIIESDLERAE
ERAELSEGKCAELEEELKTVTNNLKSLEAQAEKYSQKEDKYEEEIKVLSDKLKEAETRAE
FAERSVTKLEKSIDDLEEKVAHAKEENLSMHQMLDQTLLELNNM
NT seq 855 nt   +upstreamnt  +downstreamnt
atggacgccatcaagaagaagatgcagatgctgaagctcgacaaggagaatgccttggat
cgagcggagcaggcggaggccgataagaaggcggcggaggacaggagcaagcagctggaa
gatgagctggtgtcgctgcaaaagaaactcaagggcactgaagatgaactggacaaatac
tccgaggctctcaaagatgcccaggagaagctggaactggcagagaaaaaggccaccgac
gctgaagccgatgtagcgtctctgaataggcgcatccagctggttgaggaagagttggat
cgtgcccaagagcgtctggcaacagctttgcagaaattggaggaggccgagaaggcagca
gatgagagtgaaagaggcatgaaagtcattgaaagccgagcccaaaaagatgaggagaaa
atggaaattcaggagatccaactgaaagaggccaagcacattgctgaagatgctgaccgc
aagtatgaagaggtggcccggaaactggtcatcattgagagtgacctggaacgtgcggag
gagcgggctgagctctcagaaggcaaatgtgccgagcttgaagaagagttgaaaactgtg
acgaacaacctgaagtcactggaggctcaggctgagaagtactctcaaaaggaagacaaa
tacgaggaagagatcaaggtcctttctgacaagctgaaggaggctgagactcgggctgag
tttgcagagaggtcagtaactaagttggagaaaagcattgatgacctagaagagaaagtg
gctcatgccaaagaagaaaaccttagtatgcatcagatgctggatcagactttactggag
ttaaacaacatgtga

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107509189
Entry
107509189         CDS       T06036                                 

Gene name
TPM3
Definition
(RefSeq) tropomyosin alpha-3 chain isoform X1
  KO
K09290  tropomyosin 3
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04260  Cardiac muscle contraction
ray04261  Adrenergic signaling in cardiomyocytes
ray05200  Pathways in cancer
ray05216  Thyroid cancer
ray05410  Hypertrophic cardiomyopathy
ray05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:ray00001]
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    107509189 (TPM3)
   04261 Adrenergic signaling in cardiomyocytes
    107509189 (TPM3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107509189 (TPM3)
  09162 Cancer: specific types
   05216 Thyroid cancer
    107509189 (TPM3)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    107509189 (TPM3)
   05414 Dilated cardiomyopathy
    107509189 (TPM3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:ray04812]
    107509189 (TPM3)
Cytoskeleton proteins [BR:ray04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Tropomyosins
     107509189 (TPM3)
SSDB
Motif
Pfam: Tropomyosin Tropomyosin_1 Laminin_II CLZ TMF_DNA_bd ERM ATG16 Crescentin DHR10 DUF4200 CENP-F_leu_zip MAD DUF745 ADIP Laminin_I Fib_alpha HrpB7
Other DBs
NCBI-GeneID: 107509189
NCBI-ProteinID: XP_015996999
LinkDB
Position
Unknown
AA seq 284 aa
MEAIKKKMQMLKLDKENALDRAEQAEAEQKQVEERSKQLEDELAAMQKKLKGTEDELDKY
SEALKDAQEKLELAEKKAADAEAEVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAA
DESERGMKVIENRALKDEEKMELQEIQLKEAKHIAEEADRKYEEVARKLVIIEGDLERTE
ERAELAESRCREMDEQIRLMDQNLKCLSAAEEKYSQKEDKYEEEIKILTDKLKEAETRAE
FAERSVAKLEKTIDDLEDKLKCTKEEHLCTQRMLDQTLLDLNEM
NT seq 855 nt   +upstreamnt  +downstreamnt
atggaggccatcaagaaaaagatgcagatgctgaagctggacaaggagaatgctctggat
cgtgcagagcaagccgaggccgagcagaagcaggtggaagaaagaagcaaacagctggaa
gatgagctggcagccatgcagaagaagctcaaagggacagaggatgagctggacaagtac
tctgaagctctgaaggatgcccaggagaagctggagctggcagagaagaaggcggctgac
gctgaggccgaggtggcgtccctgaaccgtaggatccagctggttgaagaggagctggac
cgcgcccaggagcgcctggccaccgccctgcagaagctggaggaggctgagaaggctgcg
gacgagagcgagcgaggtatgaaggttattgaaaaccgagccttaaaagatgaagagaag
atggaactccaggaaatccaactcaaagaagctaagcacatcgcagaggaggcggatcgg
aagtacgaagaggtggctcgcaagctggtgatcatcgagggggacttggaacgcacggag
gagcgagccgagctggccgagtcccgttgccgagagatggatgagcagatcagactgatg
gaccagaacctgaagtgtctgagtgctgctgaggaaaagtactctcagaaagaagacaaa
tatgaggaggagataaagatcctcaccgataaactcaaggaggcagagacccgcgcagag
tttgcggagagatcggtagccaagctggaaaagaccatcgacgatttggaagataaactg
aaatgcaccaaagaggaacacctctgtacacaaaggatgctggaccagactctgcttgac
ctgaatgagatgtag

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107517241
Entry
107517241         CDS       T06036                                 

Gene name
TPM4
Definition
(RefSeq) tropomyosin alpha-4 chain isoform X1
  KO
K10375  tropomyosin 4
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04260  Cardiac muscle contraction
ray04261  Adrenergic signaling in cardiomyocytes
ray05410  Hypertrophic cardiomyopathy
ray05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:ray00001]
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    107517241 (TPM4)
   04261 Adrenergic signaling in cardiomyocytes
    107517241 (TPM4)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    107517241 (TPM4)
   05414 Dilated cardiomyopathy
    107517241 (TPM4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:ray04812]
    107517241 (TPM4)
Cytoskeleton proteins [BR:ray04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Tropomyosins
     107517241 (TPM4)
SSDB
Motif
Pfam: Tropomyosin Tropomyosin_1 CLZ Laminin_II ERM DUF3450 Crescentin ATG16 TMF_DNA_bd CENP-F_leu_zip ADIP Laminin_I PspA_IM30 GAS CCDC144C DUF1664 FPP DHR10 DUF745 HrpB7 Spc7 XhlA FliJ Fib_alpha MAD
Other DBs
NCBI-GeneID: 107517241
NCBI-ProteinID: XP_016013251
LinkDB
Position
Unknown
AA seq 284 aa
MEAIKKKMQMLKLDKENAIDRAEQAESDKKAAEEKCKQVEEELTHLQKKLKGTEDELDKY
SEDLKDAQEKLELTEKKASDAEGDVAALNRRIQLVEEELDRAQERLATALQKLEEAEKAA
DESERGMKVIENRAMKDEEKMEIQELQLKEAKHIAEEADRKYEEVARKLVILEGELERAE
ERAEVSELKCGDLEEELKNVTNNLKSLEAASEKYSEKEDKYEEEIKLLSDKLKEAETRAE
FAERTVAKLEKSIDDLEEKLAQAKEENVGLHQTLDQTLNELNCI
NT seq 855 nt   +upstreamnt  +downstreamnt
atggaggccatcaagaagaagatgcaaatgctgaagctggacaaggagaacgccatcgac
cgggcagagcaagcggagtcggataagaaagctgctgaggagaagtgcaagcaggtggag
gaggagctgacgcacctccagaagaaactgaaggggacggaggatgagctggacaagtac
tcggaggacctgaaagacgcgcaggagaagctggagctgactgagaagaaggcctcggac
gccgaaggggatgtggcagctctcaacagacgcatccagctcgtggaggaggagttggac
agggctcaagaacgactggccacggccctgcaaaagctggaggaagcagaaaaggctgct
gatgaaagcgagagaggaatgaaggtgatagaaaaccgggccatgaaagatgaggagaag
atggagatccaggagttgcagctcaaagaggccaagcacattgcagaggaggccgaccgc
aaatacgaggaggtagctcgtaagttggtcatcctggagggtgagctggagagggcggag
gagcgtgccgaggtgtctgaactaaaatgtggtgacctggaagaagaactcaagaacgtc
actaacaacctgaagtcgctggaggccgcctctgaaaagtattctgaaaaggaggataaa
tatgaagaagaaattaaacttctgtctgacaaactgaaagaggctgagacccgtgctgaa
tttgcagagcgaacggttgcaaaactggaaaagtcaattgatgacctggaagaaaaactt
gcccaggccaaagaagagaacgtgggcttacatcagacactggatcagacactaaatgaa
cttaactgtatataa

DBGET integrated database retrieval system