KEGG   Rousettus aegyptiacus (Egyptian rousette): 107503061
Entry
107503061         CDS       T06036                                 

Gene name
PRKCG
Definition
(RefSeq) protein kinase C gamma type isoform X1
  KO
K19663  classical protein kinase C gamma type [EC:2.7.11.13]
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray01521  EGFR tyrosine kinase inhibitor resistance
ray04010  MAPK signaling pathway
ray04012  ErbB signaling pathway
ray04014  Ras signaling pathway
ray04015  Rap1 signaling pathway
ray04020  Calcium signaling pathway
ray04066  HIF-1 signaling pathway
ray04070  Phosphatidylinositol signaling system
ray04071  Sphingolipid signaling pathway
ray04150  mTOR signaling pathway
ray04270  Vascular smooth muscle contraction
ray04310  Wnt signaling pathway
ray04370  VEGF signaling pathway
ray04510  Focal adhesion
ray04540  Gap junction
ray04613  Neutrophil extracellular trap formation
ray04650  Natural killer cell mediated cytotoxicity
ray04666  Fc gamma R-mediated phagocytosis
ray04670  Leukocyte transendothelial migration
ray04713  Circadian entrainment
ray04720  Long-term potentiation
ray04723  Retrograde endocannabinoid signaling
ray04724  Glutamatergic synapse
ray04725  Cholinergic synapse
ray04726  Serotonergic synapse
ray04727  GABAergic synapse
ray04728  Dopaminergic synapse
ray04730  Long-term depression
ray04750  Inflammatory mediator regulation of TRP channels
ray04911  Insulin secretion
ray04916  Melanogenesis
ray04918  Thyroid hormone synthesis
ray04919  Thyroid hormone signaling pathway
ray04921  Oxytocin signaling pathway
ray04925  Aldosterone synthesis and secretion
ray04928  Parathyroid hormone synthesis, secretion and action
ray04929  GnRH secretion
ray04935  Growth hormone synthesis, secretion and action
ray04960  Aldosterone-regulated sodium reabsorption
ray04961  Endocrine and other factor-regulated calcium reabsorption
ray04970  Salivary secretion
ray04971  Gastric acid secretion
ray04972  Pancreatic secretion
ray05017  Spinocerebellar ataxia
ray05022  Pathways of neurodegeneration - multiple diseases
ray05031  Amphetamine addiction
ray05032  Morphine addiction
ray05143  African trypanosomiasis
ray05146  Amoebiasis
ray05161  Hepatitis B
ray05163  Human cytomegalovirus infection
ray05170  Human immunodeficiency virus 1 infection
ray05171  Coronavirus disease - COVID-19
ray05200  Pathways in cancer
ray05205  Proteoglycans in cancer
ray05206  MicroRNAs in cancer
ray05214  Glioma
ray05223  Non-small cell lung cancer
ray05225  Hepatocellular carcinoma
ray05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107503061 (PRKCG)
   04012 ErbB signaling pathway
    107503061 (PRKCG)
   04014 Ras signaling pathway
    107503061 (PRKCG)
   04015 Rap1 signaling pathway
    107503061 (PRKCG)
   04310 Wnt signaling pathway
    107503061 (PRKCG)
   04370 VEGF signaling pathway
    107503061 (PRKCG)
   04066 HIF-1 signaling pathway
    107503061 (PRKCG)
   04020 Calcium signaling pathway
    107503061 (PRKCG)
   04070 Phosphatidylinositol signaling system
    107503061 (PRKCG)
   04071 Sphingolipid signaling pathway
    107503061 (PRKCG)
   04150 mTOR signaling pathway
    107503061 (PRKCG)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107503061 (PRKCG)
   04540 Gap junction
    107503061 (PRKCG)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    107503061 (PRKCG)
   04650 Natural killer cell mediated cytotoxicity
    107503061 (PRKCG)
   04666 Fc gamma R-mediated phagocytosis
    107503061 (PRKCG)
   04670 Leukocyte transendothelial migration
    107503061 (PRKCG)
  09152 Endocrine system
   04911 Insulin secretion
    107503061 (PRKCG)
   04929 GnRH secretion
    107503061 (PRKCG)
   04921 Oxytocin signaling pathway
    107503061 (PRKCG)
   04935 Growth hormone synthesis, secretion and action
    107503061 (PRKCG)
   04918 Thyroid hormone synthesis
    107503061 (PRKCG)
   04919 Thyroid hormone signaling pathway
    107503061 (PRKCG)
   04928 Parathyroid hormone synthesis, secretion and action
    107503061 (PRKCG)
   04916 Melanogenesis
    107503061 (PRKCG)
   04925 Aldosterone synthesis and secretion
    107503061 (PRKCG)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    107503061 (PRKCG)
  09154 Digestive system
   04970 Salivary secretion
    107503061 (PRKCG)
   04971 Gastric acid secretion
    107503061 (PRKCG)
   04972 Pancreatic secretion
    107503061 (PRKCG)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    107503061 (PRKCG)
   04961 Endocrine and other factor-regulated calcium reabsorption
    107503061 (PRKCG)
  09156 Nervous system
   04724 Glutamatergic synapse
    107503061 (PRKCG)
   04727 GABAergic synapse
    107503061 (PRKCG)
   04725 Cholinergic synapse
    107503061 (PRKCG)
   04728 Dopaminergic synapse
    107503061 (PRKCG)
   04726 Serotonergic synapse
    107503061 (PRKCG)
   04720 Long-term potentiation
    107503061 (PRKCG)
   04730 Long-term depression
    107503061 (PRKCG)
   04723 Retrograde endocannabinoid signaling
    107503061 (PRKCG)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    107503061 (PRKCG)
  09159 Environmental adaptation
   04713 Circadian entrainment
    107503061 (PRKCG)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107503061 (PRKCG)
   05206 MicroRNAs in cancer
    107503061 (PRKCG)
   05205 Proteoglycans in cancer
    107503061 (PRKCG)
   05231 Choline metabolism in cancer
    107503061 (PRKCG)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    107503061 (PRKCG)
   05214 Glioma
    107503061 (PRKCG)
   05223 Non-small cell lung cancer
    107503061 (PRKCG)
  09164 Neurodegenerative disease
   05017 Spinocerebellar ataxia
    107503061 (PRKCG)
   05022 Pathways of neurodegeneration - multiple diseases
    107503061 (PRKCG)
  09165 Substance dependence
   05031 Amphetamine addiction
    107503061 (PRKCG)
   05032 Morphine addiction
    107503061 (PRKCG)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    107503061 (PRKCG)
   05161 Hepatitis B
    107503061 (PRKCG)
   05171 Coronavirus disease - COVID-19
    107503061 (PRKCG)
   05163 Human cytomegalovirus infection
    107503061 (PRKCG)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    107503061 (PRKCG)
   05143 African trypanosomiasis
    107503061 (PRKCG)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    107503061 (PRKCG)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ray01001]
    107503061 (PRKCG)
Enzymes [BR:ray01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.13  protein kinase C
     107503061 (PRKCG)
Protein kinases [BR:ray01001]
 Serine/threonine kinases: AGC group
  PKC family [OT]
   107503061 (PRKCG)
SSDB
Motif
Pfam: Pkinase C1_1 PK_Tyr_Ser-Thr C2 Pkinase_C Kinase-like APH
Other DBs
NCBI-GeneID: 107503061
NCBI-ProteinID: XP_015986402
LinkDB
Position
Unknown
AA seq 697 aa
MAGLGPGGGDSEGGPRPLFCRKGALRQKVVHEVKSHKFTARFFKQPTFCSHCTDFIWGIG
KQGLQCQVCSFVVHRRCHEFVTFECPGAGKGPQTDDPRNKHKFRLHSYSSPTFCDHCGSL
LYGLVHQGMKCSCCEMNVHRRCVRSVPSLCGVDHTERRGRLQLEIRAPTADEIHITVGEA
RNLIPMDPNGLSDPYVKLKLIPDPRNLTKQKTRTVKATLNPVWNETFVFNLKPGDVERRL
SVEVWDWDRTSRNDFMGAMSFGVSELLKAPVDGWYKLLNQEEGEYYNVPVADADNCSLLQ
KFEACNYPLELYERVRMGPSSSPIPSPSPSPTDSKRCFFGASPGRLHISDFSFLMVLGKG
SFGKVMLAERRGSDELYAIKILKKDVIVQDDDVDCTLVEKRVLALGGRGPGGRPHFLTQL
HSTFQTPDRLYFVMEYVTGGDLMYHIQQLGKFKEPHAAFYAAEIAIGLFFLHNQGIIYRD
LKLDNVMLDAEGHIKITDFGMCKENVFPGTTTRTFCGTPDYIAPEIIAYQPYGKSVDWWS
FGVLLYEMLAGQPPFDGEDEEELFQAIMEQTVTYPKSLSREAVAICKGFLTKHPAKRLGS
GLDGEPTIRAHGFFRWIDWDRLERLEIPPPFRPRPCGRSGENFDKFFTRAAPALTPPDRL
VLASIDQADFQGFTYVNPDFVHPDARSPISPTPVPVM
NT seq 2094 nt   +upstreamnt  +downstreamnt
atggcaggcctgggccccggcggcggcgattcagagggggggccccggcccctattttgt
agaaagggggctctgaggcagaaggtggtccacgaagtcaagagccacaagttcaccgct
cgcttcttcaagcagccaaccttctgcagccactgcaccgacttcatctgggggattgga
aaacagggcctgcaatgtcaagtctgcagttttgtggttcatcggcgatgccacgaattt
gtgaccttcgagtgtccaggcgcggggaagggcccccagacggacgatccccggaacaag
cacaagttccgcctgcacagctacagtagccccaccttctgcgaccactgcggctccctc
ctttacgggctggtacatcagggcatgaaatgctcctgctgcgagatgaacgtgcatcgg
cgctgcgtgcgcagcgtgccctctctgtgcggcgtggaccacacagagcgtcgcgggcgc
ctgcagttggaaatccgggctccgaccgcagatgagatccacatcacggttggtgaggcc
cggaatctcatcccaatggaccccaatggtctgtctgacccttatgtgaaactgaagctc
attccagaccctcggaacttgacaaaacagaagacccggaccgtgaaagccactctgaac
cctgtgtggaacgagacctttgtgttcaacctgaagcctggggatgtggaacgccggctc
agtgtggaggtgtgggactgggaccggacctcccgcaatgacttcatgggtgccatgtct
tttggggtctcagagctgctcaaggcaccagtggatggatggtacaagttactgaaccag
gaggagggcgaatattacaatgtgccggtggctgatgctgacaactgcagcctcctccag
aagtttgaggcctgtaactaccccctggaactatatgagcgagtgcggatgggtccttcc
tcctctcccatcccctccccatcccctagtcccaccgactccaagcgctgtttctttggg
gcaagtcctggacgtctgcacatctctgacttcagcttcctcatggttctggggaaaggc
agctttgggaaggtgatgctggccgagcgtaggggctccgatgagctctacgccatcaag
atcctgaagaaagacgtgatcgtacaggatgatgatgtggactgcaccctggtggagaaa
cgcgtgctggccctgggaggcagaggccccggaggccggccccactttctcacccagctc
cactccaccttccagaccccggatcgcttgtattttgtgatggaatatgtcaccgggggc
gacttgatgtaccacattcagcagctgggcaaatttaaggagccccatgcagcgttctat
gcagcggaaatcgccatcggcctcttcttccttcacaatcagggcatcatctaccgggac
ctgaaattggacaatgtgatgctcgacgcggaaggacacatcaaaatcactgacttcggc
atgtgtaaagaaaacgttttccccgggaccacaacccgcactttctgcgggaccccagac
tacatagccccggagattattgcctaccagccctatgggaaatctgttgactggtggtcc
tttggggtgctgctgtatgaaatgttggcaggacagcccccctttgatggggaggatgaa
gaggagctgtttcaggctatcatggaacaaaccgtcacctaccccaagtctctctccagg
gaagccgtggccatctgcaaggggtttctaaccaaacaccctgcaaagcgcctgggttca
gggcttgacggggagcccaccatccgtgcccatggctttttccgctggatcgactgggac
cggctggaacggttggagatcccacctccgtttagaccccgcccgtgtggccgcagcggc
gagaacttcgacaagttcttcacgcgggcggcgccagcgctgacgcccccggaccgccta
gttctggccagcatcgaccaggcagatttccaaggcttcacctacgtaaacccggatttc
gtgcacccggatgcccgcagccccatcagcccaacgcctgtgccagtcatgtaa

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107505977
Entry
107505977         CDS       T06036                                 

Gene name
PRKCQ
Definition
(RefSeq) protein kinase C theta type isoform X1
  KO
K18052  novel protein kinase C theta type [EC:2.7.11.13]
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04064  NF-kappa B signaling pathway
ray04140  Autophagy - animal
ray04270  Vascular smooth muscle contraction
ray04658  Th1 and Th2 cell differentiation
ray04659  Th17 cell differentiation
ray04660  T cell receptor signaling pathway
ray04750  Inflammatory mediator regulation of TRP channels
ray04920  Adipocytokine signaling pathway
ray04931  Insulin resistance
ray05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    107505977 (PRKCQ)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    107505977 (PRKCQ)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    107505977 (PRKCQ)
   04658 Th1 and Th2 cell differentiation
    107505977 (PRKCQ)
   04659 Th17 cell differentiation
    107505977 (PRKCQ)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    107505977 (PRKCQ)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    107505977 (PRKCQ)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    107505977 (PRKCQ)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    107505977 (PRKCQ)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    107505977 (PRKCQ)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ray01001]
    107505977 (PRKCQ)
Enzymes [BR:ray01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.13  protein kinase C
     107505977 (PRKCQ)
Protein kinases [BR:ray01001]
 Serine/threonine kinases: AGC group
  PKC family [OT]
   107505977 (PRKCQ)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr C1_1 Pkinase_C Kinase-like Zf_RING zf-RING_9 zf-RING-like C1_2 APH
Other DBs
NCBI-GeneID: 107505977
NCBI-ProteinID: XP_015991895
LinkDB
Position
Unknown
AA seq 706 aa
MSPFLRIGLSNFDCGSCQPCQGEAVNPYCAVLVKEYVESENGQMYVQKKPTMYPPWDSTF
DAHINKGRVMQIIVKGKNVDLISETTVELCSLAERCRKNNGKTEIWLELKPQGRMLMNAR
YFLEMSDAKDAREFETEGLFALHHRRGAIKQAKVHHVKCHEFTATFFPQPTFCSVCHEFV
WGLNKQGYQCRQCNAAIHKKCIDKVIAKCTGSAVNSRETMFHKERFKIDMPHRFKVYNYK
SPTFCEHCGTLLWGLAKQGLKCDACGMNVHHRCQTKVANLCGINQKLMAEALAMIESTQQ
ARCLRDTEHIFREGPVEIGLPCSVKSDARPPHGPALGKREPQGISWECPLGETGETGCRP
EPELNAERSSLRMKLKIEDFVLHKMLGKGSFGKVFLAEFKKTNQFFAIKALKKDVVLMDD
DVECTMVEKRVLSLAWEHPFLTHMFCTFQTKENLFFVMEYLNGGDLMHHIQSCQKFDLSR
ATFYAAEIILGLQFLHSKGIVYRDLKLDNILLDKDGHIKIADFGMCKENMLGDNRTNTFC
GTPDYIAPEILLGQKYNHSVDWWSFGVLLYEMLVGQSPFHGQDEEELFHSIRMDSPFYPR
WLEKEAKDLLVKLFVREPENRLGVRGDIRQHPLFREINWEELERKEIDPPFRPKVKSPSD
CSNFDKEFLSERPRLSSADRRLINSMDQNLFRSFSFVNPGVERLLS
NT seq 2121 nt   +upstreamnt  +downstreamnt
atgtccccgtttctccggatcggcctgtccaacttcgactgcgggtcctgccagccctgc
cagggcgaggccgtcaacccctactgcgccgtgctcgtcaaagagtacgtcgagtcggag
aatggacagatgtacgtccagaagaagccgaccatgtacccgccctgggacagcacgttc
gacgcccacatcaacaaggggcgggtgatgcagatcatcgtgaagggcaagaacgtggac
ctgatctccgagaccacggtcgagctgtgctccctggccgagcggtgccggaagaacaac
gggaagacagaaatatggctagagctgaaaccccaaggccgaatgctaatgaacgcaaga
tactttctggaaatgagtgatgcgaaggacgcgagggagttcgagacggagggcctcttc
gccctgcaccaccgccggggagccatcaagcaggccaaagtgcaccacgtcaagtgccac
gagttcacggccaccttcttcccccagcccaccttttgctccgtgtgccacgagttcgtc
tggggcctcaacaagcagggctaccagtgtcgacaatgcaatgccgccatccacaagaag
tgcatcgataaggtcatagccaagtgcacgggatcagccgtcaacagccgagaaaccatg
ttccacaaggagcggttcaaaatcgacatgccgcacagatttaaagtctacaactacaaa
agcccgaccttctgtgagcactgcgggactctgctctggggcctggccaagcaaggactg
aagtgtgacgcatgtggcatgaacgtgcatcaccgatgccagacgaaggtggccaacctg
tgcggcataaaccagaagctaatggccgaggcgctggcaatgatcgagagcacccagcag
gctcgctgcttgagagacaccgaacacatcttcagagaagggccggttgagatcggcctc
ccgtgctccgtgaaaagcgacgcaaggccacctcacgggcccgccctggggaagcgagag
ccgcagggcatctcctgggagtgtcccctgggcgagacgggggagacgggctgccgccca
gagcccgaactgaacgcggaaaggtcgtctctgcgcatgaaattgaagatcgaggatttc
gtcttgcacaaaatgttggggaaaggcagtttcggcaaggtcttcctagccgagttcaag
aagacgaatcaatttttcgcaataaaagccctgaagaaagacgtggttttgatggacgac
gatgtggagtgcacgatggtggagaagagggttctgtccctggcttgggagcacccgttc
ctcacacacatgttctgcacgttccagaccaaggaaaacctcttcttcgtgatggagtac
ctcaacggcggggacctgatgcaccacatccagagttgtcagaagttcgacctgtccaga
gccacgttttacgcggctgaaatcattctcgggctgcagttcctccactccaaaggcatc
gtgtacagggacctgaagcttgacaacatcctgttagacaaagacgggcacatcaaaata
gcggactttggaatgtgcaaagagaacatgctgggggacaacaggacgaacaccttctgc
gggacacccgactacatcgccccagagattctgctgggccagaagtacaaccactccgtg
gactggtggtccttcggcgtgctcctctacgagatgctggtcggccagtcgcccttccac
gggcaagacgaggaggagctgttccactccatccgcatggacagtcccttctacccgcgc
tggctcgagaaggaggccaaggaccttctggtgaagctcttcgtgagggagcccgagaac
aggctgggagtgaggggcgacatccgccagcaccccctgttccgcgagatcaactgggaa
gagctggaaaggaaggagatcgacccgccgttcaggcccaaagtgaaatcgccgagcgac
tgcagcaacttcgacaaggagttcctgagcgagcggccgcggctgtcctccgccgaccgc
cggctcatcaacagcatggaccagaacctgttccgcagcttctccttcgtcaaccccggg
gtggagaggctgctgtcctga

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107509571
Entry
107509571         CDS       T06036                                 

Gene name
PRKCE
Definition
(RefSeq) protein kinase C epsilon type isoform X1
  KO
K18050  novel protein kinase C epsilon type [EC:2.7.11.13]
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04022  cGMP-PKG signaling pathway
ray04071  Sphingolipid signaling pathway
ray04270  Vascular smooth muscle contraction
ray04371  Apelin signaling pathway
ray04530  Tight junction
ray04666  Fc gamma R-mediated phagocytosis
ray04750  Inflammatory mediator regulation of TRP channels
ray04925  Aldosterone synthesis and secretion
ray04930  Type II diabetes mellitus
ray04931  Insulin resistance
ray04933  AGE-RAGE signaling pathway in diabetic complications
ray05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    107509571 (PRKCE)
   04071 Sphingolipid signaling pathway
    107509571 (PRKCE)
   04022 cGMP-PKG signaling pathway
    107509571 (PRKCE)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    107509571 (PRKCE)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    107509571 (PRKCE)
  09152 Endocrine system
   04925 Aldosterone synthesis and secretion
    107509571 (PRKCE)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    107509571 (PRKCE)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    107509571 (PRKCE)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    107509571 (PRKCE)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    107509571 (PRKCE)
   04931 Insulin resistance
    107509571 (PRKCE)
   04933 AGE-RAGE signaling pathway in diabetic complications
    107509571 (PRKCE)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ray01001]
    107509571 (PRKCE)
Enzymes [BR:ray01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.13  protein kinase C
     107509571 (PRKCE)
Protein kinases [BR:ray01001]
 Serine/threonine kinases: AGC group
  PKC family [OT]
   107509571 (PRKCE)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr C1_1 C2 Pkinase_C FTA2 Kinase-like Kdo PP_M1
Other DBs
NCBI-GeneID: 107509571
NCBI-ProteinID: XP_015997697
LinkDB
Position
Unknown
AA seq 737 aa
MVVFNGLLKIKICEAVSLKPTAWSLRHAVGPRPQTFLLDPYIALNVDDSRIGQTATKQKT
NSPAWHDEFVTDVCNGRKIELAVFHDAPIGYDDFVANCTIQFEELLQNGSRHFEDWIDLE
PEGKVYVIIDLSGSSGEAPKDNEERVFRERMRPRKRQGAVRRRVHQVNGHKFMATYLRQP
TYCSHCRDFIWGVIGKQGYQCQVCTCVVHKRCHELIITKCAGLKKQETPDEVGSQRFSVN
MPHKFGIHNYKVPTFCDHCGSLLWGLLRQGLQCKVCKMNVHRRCETNVAPNCGVDARGIA
KVLADLGVTPDKITNSGQRRKKLVAGAESPQPASGSSPSEEDRSKSAPTSPCDQEIKELE
NNIRKALSFDNRGEEHRAASSMDGQLASPGENGEVRQGQAKRLGLEEFNFIKVLGKGSFG
KVMLAELKGKDEVYAVKVLKKDVILQDDDVDCTMTEKRILALARKHPYLTQLYCCFQTKD
RLFFVMEYVNGGDLMFQIQRSRKFDEPRSRFYAAEVTSALMFLHQHGVIYRDLKLDNILL
DAEGHCKLADFGMCKEGILNGVTTTTFCGTPDYIAPEILQELEYGPSVDWWALGVLMYEM
MAGQPPFEADNEDDLFESILHDDVLYPVWLSKEAVSILKAFMTKNPNKRLGCVAAQNGED
AIKQHPFFKEIDWVLLEQKKIKPPFKPRIKTKRDVNNFDQDFTREEPVLTLVDEAIVKQI
NQEEFKGFSYFGEDLMP
NT seq 2214 nt   +upstreamnt  +downstreamnt
atggtagtgttcaatggccttcttaagatcaaaatctgcgaggccgtgagcttgaagccc
acagcctggtcgctgcgccatgcagtgggaccccggccacagactttccttctcgacccc
tacatcgccctcaacgtggacgattcgcgcatcggccaaaccgccaccaagcagaagacc
aacagcccggcctggcacgatgagttcgttactgatgtgtgcaacgggcgcaaaatcgag
ctggccgtcttccacgatgcccccatcggctacgatgacttcgtggccaactgcaccatc
caatttgaggagctgctgcagaacgggagtcgccacttcgaggactggattgatctggag
ccagaaggcaaagtgtatgtgatcatcgatctttccgggtcatcaggtgaagcccctaaa
gacaatgaagagcgtgtgttcagggagcgcatgcggcccaggaagaggcagggggccgtc
aggcgcagggtccaccaggtcaatggccacaagttcatggccacctaccttcggcagccc
acctactgctcccactgcagagattttatctggggtgtcataggaaagcagggataccaa
tgtcaagtttgcacttgcgtggtccacaagcgatgccatgagctcataattacgaagtgt
gccggattaaagaaacaggaaactcctgacgaggtgggctcccagcggttcagcgtcaac
atgccccacaagttcggtatccacaactacaaggtccccaccttctgtgaccactgcggg
tccctgctctggggcctcttgcggcagggtttgcagtgtaaagtctgcaagatgaacgtt
caccgacgctgtgagaccaatgtggctcccaactgcggagtggatgccagaggtattgcc
aaggtgctggctgacctcggcgtcactccagacaaaatcaccaacagcggccagaggagg
aaaaagctcgtggctggtgctgagtccccacagcctgcttctggaagctcaccctctgag
gaggatcggtccaagtcagcacccacctccccttgtgaccaggaaattaaagaacttgaa
aacaacatccggaaggccttgtcatttgacaaccgaggtgaggagcacagggcagcatca
tccatggatggccagctggcaagccctggtgagaacggcgaagtccggcaaggccaggcc
aagcgcttgggcttggaggagttcaacttcatcaaagtgttgggcaaaggcagctttggc
aaggtcatgttggcagagctcaaaggcaaagatgaagtgtatgctgtgaaagtcttaaag
aaggatgtcatccttcaggatgatgatgtggactgcacaatgacagagaagaggattttg
gctctggcgcggaaacacccatacctaacccagctctattgctgcttccagaccaaggac
cgtctctttttcgtcatggagtatgtaaatggcggagacctcatgttccagattcagcgc
tcccgaaaattcgatgagcctcgttcccggttctatgctgcagaggtcacgtcagccctc
atgttcctccatcaacatggagtcatctacagggatttgaaactggacaacatccttctg
gatgcagaaggtcactgcaagctggccgactttgggatgtgcaaggaagggattctgaac
ggtgtgacgaccaccacattctgtgggactcctgactacattgctcctgagatcctgcaa
gagttggagtacggcccctcggtggactggtgggccctgggggttctgatgtatgagatg
atggctgggcagccccccttcgaggctgacaacgaggatgacctgtttgagtccatcctc
catgatgatgtgctctacccagtctggctcagtaaggaggccgtcagcatcctgaaagct
ttcatgactaagaaccccaacaagcgcctgggctgtgtggcggcacagaatggcgaggac
gccatcaagcagcacccgttcttcaaggagattgactgggtgctcctggagcagaagaag
atcaagccgcccttcaaacctcgaattaaaaccaaaagagatgtcaataactttgaccaa
gactttacccgggaagagccggtactcacgcttgtggatgaagcgattgtgaagcagatc
aaccaagaggaattcaaaggcttctcctactttggtgaagacctgatgccctga

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107510307
Entry
107510307         CDS       T06036                                 

Gene name
PRKCA
Definition
(RefSeq) protein kinase C alpha type isoform X1
  KO
K02677  classical protein kinase C alpha type [EC:2.7.11.13]
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray01521  EGFR tyrosine kinase inhibitor resistance
ray04010  MAPK signaling pathway
ray04012  ErbB signaling pathway
ray04014  Ras signaling pathway
ray04015  Rap1 signaling pathway
ray04020  Calcium signaling pathway
ray04066  HIF-1 signaling pathway
ray04070  Phosphatidylinositol signaling system
ray04071  Sphingolipid signaling pathway
ray04072  Phospholipase D signaling pathway
ray04150  mTOR signaling pathway
ray04151  PI3K-Akt signaling pathway
ray04261  Adrenergic signaling in cardiomyocytes
ray04270  Vascular smooth muscle contraction
ray04310  Wnt signaling pathway
ray04360  Axon guidance
ray04370  VEGF signaling pathway
ray04510  Focal adhesion
ray04540  Gap junction
ray04613  Neutrophil extracellular trap formation
ray04650  Natural killer cell mediated cytotoxicity
ray04664  Fc epsilon RI signaling pathway
ray04666  Fc gamma R-mediated phagocytosis
ray04670  Leukocyte transendothelial migration
ray04713  Circadian entrainment
ray04720  Long-term potentiation
ray04723  Retrograde endocannabinoid signaling
ray04724  Glutamatergic synapse
ray04725  Cholinergic synapse
ray04726  Serotonergic synapse
ray04727  GABAergic synapse
ray04728  Dopaminergic synapse
ray04730  Long-term depression
ray04750  Inflammatory mediator regulation of TRP channels
ray04911  Insulin secretion
ray04912  GnRH signaling pathway
ray04916  Melanogenesis
ray04918  Thyroid hormone synthesis
ray04919  Thyroid hormone signaling pathway
ray04921  Oxytocin signaling pathway
ray04925  Aldosterone synthesis and secretion
ray04926  Relaxin signaling pathway
ray04928  Parathyroid hormone synthesis, secretion and action
ray04929  GnRH secretion
ray04933  AGE-RAGE signaling pathway in diabetic complications
ray04935  Growth hormone synthesis, secretion and action
ray04960  Aldosterone-regulated sodium reabsorption
ray04961  Endocrine and other factor-regulated calcium reabsorption
ray04970  Salivary secretion
ray04971  Gastric acid secretion
ray04972  Pancreatic secretion
ray05017  Spinocerebellar ataxia
ray05022  Pathways of neurodegeneration - multiple diseases
ray05031  Amphetamine addiction
ray05032  Morphine addiction
ray05143  African trypanosomiasis
ray05146  Amoebiasis
ray05161  Hepatitis B
ray05163  Human cytomegalovirus infection
ray05164  Influenza A
ray05170  Human immunodeficiency virus 1 infection
ray05171  Coronavirus disease - COVID-19
ray05200  Pathways in cancer
ray05205  Proteoglycans in cancer
ray05206  MicroRNAs in cancer
ray05214  Glioma
ray05223  Non-small cell lung cancer
ray05225  Hepatocellular carcinoma
ray05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107510307 (PRKCA)
   04012 ErbB signaling pathway
    107510307 (PRKCA)
   04014 Ras signaling pathway
    107510307 (PRKCA)
   04015 Rap1 signaling pathway
    107510307 (PRKCA)
   04310 Wnt signaling pathway
    107510307 (PRKCA)
   04370 VEGF signaling pathway
    107510307 (PRKCA)
   04066 HIF-1 signaling pathway
    107510307 (PRKCA)
   04020 Calcium signaling pathway
    107510307 (PRKCA)
   04070 Phosphatidylinositol signaling system
    107510307 (PRKCA)
   04072 Phospholipase D signaling pathway
    107510307 (PRKCA)
   04071 Sphingolipid signaling pathway
    107510307 (PRKCA)
   04151 PI3K-Akt signaling pathway
    107510307 (PRKCA)
   04150 mTOR signaling pathway
    107510307 (PRKCA)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107510307 (PRKCA)
   04540 Gap junction
    107510307 (PRKCA)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    107510307 (PRKCA)
   04650 Natural killer cell mediated cytotoxicity
    107510307 (PRKCA)
   04664 Fc epsilon RI signaling pathway
    107510307 (PRKCA)
   04666 Fc gamma R-mediated phagocytosis
    107510307 (PRKCA)
   04670 Leukocyte transendothelial migration
    107510307 (PRKCA)
  09152 Endocrine system
   04911 Insulin secretion
    107510307 (PRKCA)
   04929 GnRH secretion
    107510307 (PRKCA)
   04912 GnRH signaling pathway
    107510307 (PRKCA)
   04921 Oxytocin signaling pathway
    107510307 (PRKCA)
   04926 Relaxin signaling pathway
    107510307 (PRKCA)
   04935 Growth hormone synthesis, secretion and action
    107510307 (PRKCA)
   04918 Thyroid hormone synthesis
    107510307 (PRKCA)
   04919 Thyroid hormone signaling pathway
    107510307 (PRKCA)
   04928 Parathyroid hormone synthesis, secretion and action
    107510307 (PRKCA)
   04916 Melanogenesis
    107510307 (PRKCA)
   04925 Aldosterone synthesis and secretion
    107510307 (PRKCA)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107510307 (PRKCA)
   04270 Vascular smooth muscle contraction
    107510307 (PRKCA)
  09154 Digestive system
   04970 Salivary secretion
    107510307 (PRKCA)
   04971 Gastric acid secretion
    107510307 (PRKCA)
   04972 Pancreatic secretion
    107510307 (PRKCA)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    107510307 (PRKCA)
   04961 Endocrine and other factor-regulated calcium reabsorption
    107510307 (PRKCA)
  09156 Nervous system
   04724 Glutamatergic synapse
    107510307 (PRKCA)
   04727 GABAergic synapse
    107510307 (PRKCA)
   04725 Cholinergic synapse
    107510307 (PRKCA)
   04728 Dopaminergic synapse
    107510307 (PRKCA)
   04726 Serotonergic synapse
    107510307 (PRKCA)
   04720 Long-term potentiation
    107510307 (PRKCA)
   04730 Long-term depression
    107510307 (PRKCA)
   04723 Retrograde endocannabinoid signaling
    107510307 (PRKCA)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    107510307 (PRKCA)
  09158 Development and regeneration
   04360 Axon guidance
    107510307 (PRKCA)
  09159 Environmental adaptation
   04713 Circadian entrainment
    107510307 (PRKCA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107510307 (PRKCA)
   05206 MicroRNAs in cancer
    107510307 (PRKCA)
   05205 Proteoglycans in cancer
    107510307 (PRKCA)
   05231 Choline metabolism in cancer
    107510307 (PRKCA)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    107510307 (PRKCA)
   05214 Glioma
    107510307 (PRKCA)
   05223 Non-small cell lung cancer
    107510307 (PRKCA)
  09164 Neurodegenerative disease
   05017 Spinocerebellar ataxia
    107510307 (PRKCA)
   05022 Pathways of neurodegeneration - multiple diseases
    107510307 (PRKCA)
  09165 Substance dependence
   05031 Amphetamine addiction
    107510307 (PRKCA)
   05032 Morphine addiction
    107510307 (PRKCA)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    107510307 (PRKCA)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    107510307 (PRKCA)
   05161 Hepatitis B
    107510307 (PRKCA)
   05171 Coronavirus disease - COVID-19
    107510307 (PRKCA)
   05164 Influenza A
    107510307 (PRKCA)
   05163 Human cytomegalovirus infection
    107510307 (PRKCA)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    107510307 (PRKCA)
   05143 African trypanosomiasis
    107510307 (PRKCA)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    107510307 (PRKCA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ray01001]
    107510307 (PRKCA)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ray04131]
    107510307 (PRKCA)
Enzymes [BR:ray01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.13  protein kinase C
     107510307 (PRKCA)
Protein kinases [BR:ray01001]
 Serine/threonine kinases: AGC group
  PKC family [OT]
   107510307 (PRKCA)
Membrane trafficking [BR:ray04131]
 Endocytosis
  Lipid raft mediated endocytosis
   Caveolin-mediated endocytosis
    107510307 (PRKCA)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr C1_1 C2 C1_2 Kinase-like
Other DBs
NCBI-GeneID: 107510307
NCBI-ProteinID: XP_015999180
LinkDB
Position
Unknown
AA seq 719 aa
MADVFPANDSTASQDVANRFARKGALRQKNVHEVKDHKFIARFFKQPTFCSHCTDFIWGF
GKQGFQCQVCCFVVHKRCHEFVTFSCPGADKGPDTDDPRSKHKFKIHTYGSPTFCDHCGS
LLYGLIHQGMKCDTCDMNVHKQCVINVPSLCGMDHTEKRGRIYLKAEVTDEKLHVTVRDA
KNLIPMDPNGLSDPYVKLKLIPDPKNESKQKTKTIRSTLNPQWNESFTFKLKPSDKDRRL
SVEIWDWDRTTRNDFMGSLSFGVSELMKMPASGWYKLLNQEEGEYYNVPIPEGDEEGNAE
LRQKFEKAKLGPAGNKVISPSEDRRQPSNNLDRVKLTDFNFLMVLGKGSFGKVMLADRKG
TEELYAIKILKKDVVIQDDDVECTMVEKRVLALLDKPPFLTQLHSCFQTVDRLYFVMEYV
NGGDLMYHIQQVGKFKEPQAVFYAAEISIGLFFLHKRGIIYRDLKLDNVMLDSEGHIKIA
DFGMCKEHMMEGVTTRTFCGTPDYIAPEIIAYQPYGKSVDWWAYGVLLYEMLAGQPPFDG
EDEDELFQSIMEHNVSYPKSLSKEAVSICKGLMTKHPGKRLGCGPEGERDVREHAFFRRI
DWEKLENREIQPPFKPKVVSQGRSPFPEPQSPQSWRCPTHPPSWREEASDPRPPQGKRLP
LPSVLWSEQGQTRPRGGCGSSVLTELSNSVAAESPPPARLNSKGGLLGVWILWTRNSWL
NT seq 2160 nt   +upstreamnt  +downstreamnt
atggctgacgttttcccggccaacgattccacggcgtctcaggacgtggccaaccgcttc
gcgcgcaaaggggcgctgagacagaagaacgtgcatgaggtgaaggaccacaaattcatc
gcccgcttcttcaagcagcccaccttctgcagccactgcaccgacttcatctgggggttt
gggaaacaaggcttccagtgccaagtttgctgttttgtggttcacaagaggtgccatgaa
tttgtcactttttcctgtccgggtgcggataagggacccgacactgatgaccccaggagc
aagcacaagtttaaaatccacacttacggaagccccaccttctgcgatcactgtgggtca
ctgctgtacggacttatccaccaagggatgaaatgcgacacctgcgacatgaacgtgcac
aagcagtgcgtaataaacgtccccagcctctgcgggatggaccacacagagaagcggggg
cggatctacctgaaggccgaggtcaccgacgaaaagctccacgtcacagtacgagatgca
aagaatctcatccctatggatccaaatggactctcagacccttacgtgaagctgaaactt
attcctgatcccaagaatgaaagcaaacaaaaaaccaaaaccatccgctccacactgaac
ccccagtggaatgagtcgttcaccttcaaattaaaaccttcggataaagaccgacgactg
tccgtggaaatctgggattgggatcgcacaacaaggaacgacttcatgggctccctttcc
ttcggcgtttcggagctgatgaagatgccggccagtggatggtacaagctgcttaaccaa
gaagaaggtgagtactacaacgtgcccattccagaaggagacgaagaagggaacgcggag
ctccggcagaaattcgagaaagccaagcttggccccgctggtaacaaagtaatcagtcct
tcagaagacaggagacaaccttccaacaaccttgacagggtgaagctcacggacttcaat
ttcctcatggtcctggggaaggggagttttggaaaggtgatgctggccgacaggaaggga
acagaagaactgtacgctatcaagatcctgaagaaggacgtggtgatccaggacgatgac
gtggaatgcaccatggtagagaagcgagtgctggctttgctcgacaagccgccgttcctg
acacagctgcactcctgcttccagacggtggatcggctctacttcgtcatggaatacgtc
aacggcggggacctcatgtaccacatccagcaagtaggaaaatttaaggaaccccaagca
gtattctatgcagcagagatttccattggattgttctttcttcataaacgaggaatcatt
tatagggacctgaagttagataacgtcatgctggattcggaagggcacatcaagatcgcc
gacttcgggatgtgcaaggagcacatgatggagggagtcacaaccaggaccttctgcggg
accccagactacatcgccccggagataatcgcttatcagccgtacgggaaatctgtggac
tggtgggcctacggcgtcctgttatatgaaatgctggctgggcagcccccattcgatggt
gaagatgaagacgagctgtttcagtctataatggagcacaacgtttcttatccgaaatct
ttatccaaggaggccgtttccatctgcaaaggactgatgaccaaacatcccggcaagcgt
ctgggctgcgggcccgagggggaacgggacgtgcgagaacacgccttcttccggaggatc
gactgggagaaactggagaacagggagatccagccgccgttcaagcccaaagtggtgagc
caagggcgcagcccgtttcctgagccccagtccccccaatcctggaggtgtcccacccac
cctccttcttggagagaggaggccagtgacccccggcctccacagggcaagcgcctgccc
ttgccgtcggttctgtggtccgagcaagggcagaccaggccgcgaggcgggtgcgggtct
tctgtcctcacagagctgtccaatagcgtggctgcagagagccccccaccagcccgatta
aacagcaagggaggtctgcttggggtttggattttgtggactcggaattcctggctctga

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107516091
Entry
107516091         CDS       T06036                                 

Gene name
PRKCB
Definition
(RefSeq) protein kinase C beta type isoform X1
  KO
K19662  classical protein kinase C beta type [EC:2.7.11.13]
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray01521  EGFR tyrosine kinase inhibitor resistance
ray04010  MAPK signaling pathway
ray04012  ErbB signaling pathway
ray04014  Ras signaling pathway
ray04015  Rap1 signaling pathway
ray04020  Calcium signaling pathway
ray04062  Chemokine signaling pathway
ray04064  NF-kappa B signaling pathway
ray04066  HIF-1 signaling pathway
ray04070  Phosphatidylinositol signaling system
ray04071  Sphingolipid signaling pathway
ray04150  mTOR signaling pathway
ray04270  Vascular smooth muscle contraction
ray04310  Wnt signaling pathway
ray04370  VEGF signaling pathway
ray04510  Focal adhesion
ray04540  Gap junction
ray04613  Neutrophil extracellular trap formation
ray04650  Natural killer cell mediated cytotoxicity
ray04662  B cell receptor signaling pathway
ray04666  Fc gamma R-mediated phagocytosis
ray04670  Leukocyte transendothelial migration
ray04713  Circadian entrainment
ray04720  Long-term potentiation
ray04723  Retrograde endocannabinoid signaling
ray04724  Glutamatergic synapse
ray04725  Cholinergic synapse
ray04726  Serotonergic synapse
ray04727  GABAergic synapse
ray04728  Dopaminergic synapse
ray04730  Long-term depression
ray04750  Inflammatory mediator regulation of TRP channels
ray04911  Insulin secretion
ray04912  GnRH signaling pathway
ray04916  Melanogenesis
ray04918  Thyroid hormone synthesis
ray04919  Thyroid hormone signaling pathway
ray04921  Oxytocin signaling pathway
ray04925  Aldosterone synthesis and secretion
ray04928  Parathyroid hormone synthesis, secretion and action
ray04929  GnRH secretion
ray04931  Insulin resistance
ray04933  AGE-RAGE signaling pathway in diabetic complications
ray04935  Growth hormone synthesis, secretion and action
ray04960  Aldosterone-regulated sodium reabsorption
ray04961  Endocrine and other factor-regulated calcium reabsorption
ray04970  Salivary secretion
ray04971  Gastric acid secretion
ray04972  Pancreatic secretion
ray04973  Carbohydrate digestion and absorption
ray05017  Spinocerebellar ataxia
ray05022  Pathways of neurodegeneration - multiple diseases
ray05031  Amphetamine addiction
ray05032  Morphine addiction
ray05140  Leishmaniasis
ray05143  African trypanosomiasis
ray05146  Amoebiasis
ray05161  Hepatitis B
ray05163  Human cytomegalovirus infection
ray05164  Influenza A
ray05170  Human immunodeficiency virus 1 infection
ray05171  Coronavirus disease - COVID-19
ray05200  Pathways in cancer
ray05205  Proteoglycans in cancer
ray05206  MicroRNAs in cancer
ray05214  Glioma
ray05223  Non-small cell lung cancer
ray05225  Hepatocellular carcinoma
ray05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107516091 (PRKCB)
   04012 ErbB signaling pathway
    107516091 (PRKCB)
   04014 Ras signaling pathway
    107516091 (PRKCB)
   04015 Rap1 signaling pathway
    107516091 (PRKCB)
   04310 Wnt signaling pathway
    107516091 (PRKCB)
   04370 VEGF signaling pathway
    107516091 (PRKCB)
   04064 NF-kappa B signaling pathway
    107516091 (PRKCB)
   04066 HIF-1 signaling pathway
    107516091 (PRKCB)
   04020 Calcium signaling pathway
    107516091 (PRKCB)
   04070 Phosphatidylinositol signaling system
    107516091 (PRKCB)
   04071 Sphingolipid signaling pathway
    107516091 (PRKCB)
   04150 mTOR signaling pathway
    107516091 (PRKCB)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107516091 (PRKCB)
   04540 Gap junction
    107516091 (PRKCB)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    107516091 (PRKCB)
   04650 Natural killer cell mediated cytotoxicity
    107516091 (PRKCB)
   04662 B cell receptor signaling pathway
    107516091 (PRKCB)
   04666 Fc gamma R-mediated phagocytosis
    107516091 (PRKCB)
   04670 Leukocyte transendothelial migration
    107516091 (PRKCB)
   04062 Chemokine signaling pathway
    107516091 (PRKCB)
  09152 Endocrine system
   04911 Insulin secretion
    107516091 (PRKCB)
   04929 GnRH secretion
    107516091 (PRKCB)
   04912 GnRH signaling pathway
    107516091 (PRKCB)
   04921 Oxytocin signaling pathway
    107516091 (PRKCB)
   04935 Growth hormone synthesis, secretion and action
    107516091 (PRKCB)
   04918 Thyroid hormone synthesis
    107516091 (PRKCB)
   04919 Thyroid hormone signaling pathway
    107516091 (PRKCB)
   04928 Parathyroid hormone synthesis, secretion and action
    107516091 (PRKCB)
   04916 Melanogenesis
    107516091 (PRKCB)
   04925 Aldosterone synthesis and secretion
    107516091 (PRKCB)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    107516091 (PRKCB)
  09154 Digestive system
   04970 Salivary secretion
    107516091 (PRKCB)
   04971 Gastric acid secretion
    107516091 (PRKCB)
   04972 Pancreatic secretion
    107516091 (PRKCB)
   04973 Carbohydrate digestion and absorption
    107516091 (PRKCB)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    107516091 (PRKCB)
   04961 Endocrine and other factor-regulated calcium reabsorption
    107516091 (PRKCB)
  09156 Nervous system
   04724 Glutamatergic synapse
    107516091 (PRKCB)
   04727 GABAergic synapse
    107516091 (PRKCB)
   04725 Cholinergic synapse
    107516091 (PRKCB)
   04728 Dopaminergic synapse
    107516091 (PRKCB)
   04726 Serotonergic synapse
    107516091 (PRKCB)
   04720 Long-term potentiation
    107516091 (PRKCB)
   04730 Long-term depression
    107516091 (PRKCB)
   04723 Retrograde endocannabinoid signaling
    107516091 (PRKCB)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    107516091 (PRKCB)
  09159 Environmental adaptation
   04713 Circadian entrainment
    107516091 (PRKCB)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107516091 (PRKCB)
   05206 MicroRNAs in cancer
    107516091 (PRKCB)
   05205 Proteoglycans in cancer
    107516091 (PRKCB)
   05231 Choline metabolism in cancer
    107516091 (PRKCB)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    107516091 (PRKCB)
   05214 Glioma
    107516091 (PRKCB)
   05223 Non-small cell lung cancer
    107516091 (PRKCB)
  09164 Neurodegenerative disease
   05017 Spinocerebellar ataxia
    107516091 (PRKCB)
   05022 Pathways of neurodegeneration - multiple diseases
    107516091 (PRKCB)
  09165 Substance dependence
   05031 Amphetamine addiction
    107516091 (PRKCB)
   05032 Morphine addiction
    107516091 (PRKCB)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    107516091 (PRKCB)
   04933 AGE-RAGE signaling pathway in diabetic complications
    107516091 (PRKCB)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    107516091 (PRKCB)
   05161 Hepatitis B
    107516091 (PRKCB)
   05171 Coronavirus disease - COVID-19
    107516091 (PRKCB)
   05164 Influenza A
    107516091 (PRKCB)
   05163 Human cytomegalovirus infection
    107516091 (PRKCB)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    107516091 (PRKCB)
   05140 Leishmaniasis
    107516091 (PRKCB)
   05143 African trypanosomiasis
    107516091 (PRKCB)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    107516091 (PRKCB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ray01001]
    107516091 (PRKCB)
Enzymes [BR:ray01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.13  protein kinase C
     107516091 (PRKCB)
Protein kinases [BR:ray01001]
 Serine/threonine kinases: AGC group
  PKC family [OT]
   107516091 (PRKCB)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr C1_1 C2 Pkinase_C Kinase-like C1_2 CEP76-C2 APH
Other DBs
NCBI-GeneID: 107516091
NCBI-ProteinID: XP_016010998
LinkDB
Position
Unknown
AA seq 673 aa
MAEPAAGPPPGEGEEGAVRFARKGALRQKNVHEVKDHKFTARFFKQPTFCSHCTDFIWGF
GKQGFQCQVCCFVVHKRCHEFVTFSCPGADKGPASDDPRSKHKFKIHTYSSPTFCDHCGS
LLYGLIHQGMKCDTCMMNVHKRCVMNVPSLCGTDHTERRGRISIKAQIEKEVLTVVVRDA
KNLVPMDPNGLSDPYVKLKLIPDPKSESKQKTKTIKCSLNPEWNETFRFQLKESDKDRRL
SVEIWDWDLTSRNDFMGSLSFGISELQKAGVDGWFKLLSQEEGEYFNVPVPPEAGECDDD
LRQKFERAKIGQAPKTPEEKTTNATSKCDTNGSKDRMKLTDFNFLMVLGKGSFGKVMLSE
RKGTDELYAVKILKKDVVIQDDDVECTMVEKRVLALPGKPPFLTQLHSCFQTMDRLYFVM
EYVNGGDLMYHIQQVGRFKEPHAVFYAAEIAIGLFFLQSKGIIYRDLKLDNVMLDSEGHV
KIADFGMCKENMWDGVTTKTFCGTPDYIAPEIIAYQPYGKSVDWWAFGVLLYEMLAGQAP
FEGEDEDELFQSIMEHTVAYPKSMSKEAVAICKGLMTKHPGKRLGCGPEGERDVKEHAFF
RYIDWEKLERKEIQPPYKPKACGRNAENFDRFFTRHPPVLTPPDHEVIRNIDQSEFEGFS
FVNSEFLKPEVKS
NT seq 2022 nt   +upstreamnt  +downstreamnt
atggctgagccggccgcgggcccgccgccgggcgagggcgaggagggcgccgtgcgcttc
gcccgcaaaggcgccctccggcagaagaacgtgcacgaggtgaaggaccacaaattcacc
gcccgcttcttcaagcagcccaccttctgcagccactgcaccgacttcatctggggcttc
gggaagcaaggatttcagtgccaagtctgctgtttcgtcgtgcacaagcggtgccatgag
tttgtcaccttctcctgcccgggcgctgacaagggccccgcctccgacgacccccggagc
aaacacaagttcaagatccacacgtactccagccccacgttctgcgaccactgcgggtcc
ctgctgtacgggctcatccaccagggcatgaaatgcgacacctgcatgatgaacgtgcac
aaacgctgcgtgatgaacgtgccgagcctctgcggcacggaccacacggagcgccgcggc
cgcatctccatcaaggcacagatcgagaaggaagtgctcaccgtggtcgtgagagacgct
aaaaacctcgtccccatggaccccaacggcttgtcagacccctacgtgaagctgaaactc
attcccgaccccaaaagcgagagcaagcagaagaccaaaaccatcaagtgctccctgaac
cccgagtggaacgagaccttcagattccagctgaaggaatcggacaaggaccggaggctg
tccgtggagatctgggactgggacctgaccagccggaacgacttcatggggtccttgtcg
ttcgggatctccgagctgcagaaggccggcgtcgacggctggttcaagctgctgagccag
gaggagggcgagtacttcaacgtgccggtgccgcccgaggccggcgagtgcgacgacgac
ctgcgccagaagttcgagagggccaagatcggtcaggcgcccaagaccccggaggagaag
acgaccaatgccacctccaagtgcgacaccaacggcagcaaggaccggatgaagctgacc
gacttcaacttcctgatggtgctgggcaagggcagcttcggcaaggtcatgctctcagag
cggaagggcacggacgagctgtacgccgtcaagatcctgaagaaggacgtggtgatccag
gacgacgacgtggagtgcacgatggtggagaagcgcgtgctcgcgctgcccgggaagccg
cccttcctcacacagctgcactcctgcttccagaccatggaccgcctgtacttcgtgatg
gagtatgtgaacggcggggacctcatgtaccacatccagcaggtcggccggttcaaggag
cctcacgccgtattctacgccgcagaaatcgccatcgggctgttcttcctgcagagcaag
ggcatcatttaccgcgacctgaaactcgacaacgtgatgctggactctgagggccacgtg
aagatcgccgacttcggcatgtgcaaggagaacatgtgggacggggtgaccaccaagacc
ttctgcggcaccccggactacatcgcccccgagatcatcgcttaccagccctacgggaag
tcggtggactggtgggcgttcggcgtcctgctctacgaaatgctggccgggcaggcgccg
ttcgaaggggaggacgaggacgagctcttccagtccatcatggagcacaccgtggcctac
ccgaagtccatgtccaaggaggccgtggccatctgcaaagggctgatgaccaagcacccg
ggcaagcgcctgggctgcgggcccgaaggcgagcgcgatgtcaaggagcatgcgttcttc
cggtacatcgactgggagaagctggagcgcaaggagatccagccgccgtacaagccgaaa
gcctgtgggcgaaacgccgaaaacttcgaccggtttttcacccgccaccctccagtccta
actcctcccgaccacgaagtcatcaggaacattgaccaatcagaatttgaaggattttcc
tttgttaactctgagtttctaaaacccgaagtcaagagctga

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107516555
Entry
107516555         CDS       T06036                                 

Gene name
PRKCD
Definition
(RefSeq) protein kinase C delta type isoform X1
  KO
K06068  novel protein kinase C delta type [EC:2.7.11.13]
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04062  Chemokine signaling pathway
ray04140  Autophagy - animal
ray04270  Vascular smooth muscle contraction
ray04621  NOD-like receptor signaling pathway
ray04625  C-type lectin receptor signaling pathway
ray04666  Fc gamma R-mediated phagocytosis
ray04722  Neurotrophin signaling pathway
ray04750  Inflammatory mediator regulation of TRP channels
ray04912  GnRH signaling pathway
ray04915  Estrogen signaling pathway
ray04930  Type II diabetes mellitus
ray04931  Insulin resistance
ray04933  AGE-RAGE signaling pathway in diabetic complications
ray05020  Prion disease
Brite
KEGG Orthology (KO) [BR:ray00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    107516555 (PRKCD)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    107516555 (PRKCD)
   04625 C-type lectin receptor signaling pathway
    107516555 (PRKCD)
   04666 Fc gamma R-mediated phagocytosis
    107516555 (PRKCD)
   04062 Chemokine signaling pathway
    107516555 (PRKCD)
  09152 Endocrine system
   04912 GnRH signaling pathway
    107516555 (PRKCD)
   04915 Estrogen signaling pathway
    107516555 (PRKCD)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    107516555 (PRKCD)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    107516555 (PRKCD)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    107516555 (PRKCD)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05020 Prion disease
    107516555 (PRKCD)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    107516555 (PRKCD)
   04931 Insulin resistance
    107516555 (PRKCD)
   04933 AGE-RAGE signaling pathway in diabetic complications
    107516555 (PRKCD)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ray01001]
    107516555 (PRKCD)
Enzymes [BR:ray01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.13  protein kinase C
     107516555 (PRKCD)
Protein kinases [BR:ray01001]
 Serine/threonine kinases: AGC group
  PKC family [OT]
   107516555 (PRKCD)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr C1_1 Pkinase_C zf-RING-like Kinase-like C1_2 Pkinase_fungal Zf_RING zf-RING_9 PHD DUF2318 DZR APH
Other DBs
NCBI-GeneID: 107516555
NCBI-ProteinID: XP_016011874
LinkDB
Position
Unknown
AA seq 804 aa
MGALRFIPRPFDSNQVQCSLLHWAASIVCQRSRRAETRSPQVAGKVLAGLSWPQGAGPYR
TLCGSNPATPTALQSSDEAEPGAFLWGLWAYLHEAINSWYTLLLCRFFTLSLTTIVQTLH
KNPTAGPNMAPFLRIAFNSYELGSLQATDEASQPFCAVKMKEALSTERGKTLVQKKPTMY
PEWKSTFDAHIYEGRVIQIVLMRAAEEPVSEVTVGVSVLAERCKKNNGKAEFWLDLQPQA
KVLMSVQYFLEDGDCKQSIRGEDEAMFPTMIRRGAIKQAKIHYIKNHEFIATFFRQPTFC
SVCKDFVWGLNKQGYKCRQCNAAIHKKCIDKIIGRCTGTATNSRDTIFQKERFNIDMPHR
FKVYNYMSPTFCDHCGSLLWGLVKQGLKCEDCGMNVHHKCQKKVANLCGINQKLLAEALN
QVSQRSVRKSETEPAEPFGIYQHFEKKPGVSGDDVPADNGTYGKIWEGSTRCNIENFIFH
KVLGKGSFGKVLLAELKGKKEFFAVKALKKDVVLIDDDVECTMVEKRVLALAWENPFLTH
LFCTFQTKDHLFFVMEFLNGGDLMYHIQDKGRFELYRATFYAAEIVCGLQFLHDKGIIYR
DLKLDNVMLDRDGHIKIADFGMCKENITGEKQASTFCGTPDYIAPEILQGLKYSFSVDWW
SFGVLLYEMLIGQSPFHGDDEDELFESIRVDTPHYPRWITKESKDILEKLLERDPAKRLG
VTGNIKTHPFFKTINWTLLEKRLVEPPFKPKVKSPGDYSNFDQEFLNEKARLSYSDKNLI
DSMDQTAFAGFSFVNPKFERLLEK
NT seq 2415 nt   +upstreamnt  +downstreamnt
atgggggctctgagattcatacccagaccctttgactccaaccaagtccagtgctctctg
cttcattgggctgcctccattgtgtgccagagaagcaggagagcagaaactaggagccca
caggtggctgggaaagtcctggctggcctcagctggccccaaggagctggcccctacaga
acgctgtgtgggtccaaccctgccacccccacggccctgcagagcagcgatgaggctgag
ccaggggccttcctctggggcctgtgggcctatttgcatgaagctataaatagttggtac
accttgcttttgtgccgtttctttaccctcagcctcactaccattgttcagacactccac
aagaaccccactgcaggccccaacatggcaccattcctgcgcattgccttcaactcctac
gagctgggctccctgcaggccacagatgaggcaagccagcccttctgtgccgtgaagatg
aaggaggcactcagcacagagcgcgggaagacactggtgcagaagaagcccaccatgtac
cctgagtggaagtccacattcgacgcccacatctacgagggccgtgtcatccagatcgtg
ctgatgcgggcagccgaggagccagtgtccgaagtgacagtgggcgtgtcagtgctggcc
gagcgctgcaagaagaacaacggcaaggctgagttctggctggacctgcaaccccaggcc
aaggtgttgatgtccgtgcagtatttcctggaagatggagattgtaagcagtctattcgg
ggtgaagacgaggccatgtttccaacaatgatccggcgtggagccatcaaacaggccaaa
atccactacatcaagaaccacgagtttatcgccaccttctttaggcagcccaccttctgt
tctgtgtgcaaagattttgtctggggtctcaacaagcaaggttacaaatgcagacaatgc
aacgctgccatccataagaaatgcatcgacaagatcatcggccggtgcactggcactgcg
accaacagccgggacaccatattccagaaagaacgtttcaacattgacatgcctcaccgg
ttcaaggtttataactacatgagccccaccttctgtgaccactgtggcagcctgctctgg
ggactggtgaaacagggattaaagtgtgaagactgtggcatgaatgtgcatcacaagtgc
cagaagaaggttgccaacctctgcggcatcaaccagaagctcttggccgaggcattgaac
caagtcagccagagatccgtccggaagtcagagacagaacctgcagagccttttgggatc
taccagcattttgaaaaaaagccaggagtctctggagacgatgtcccagcagacaacggg
acctatggcaagatctgggagggcagcaccaggtgcaacattgagaacttcatcttccac
aaggtcctgggcaaaggcagcttcgggaaggtgctgcttgcagagctgaaaggcaaaaag
gaattcttcgctgtcaaggccctcaagaaggatgtagttctgatcgacgatgatgtggag
tgcaccatggtggagaagcgggtgctggcgctcgcctgggagaatccctttctcacccac
ctcttctgtaccttccagaccaaggatcacctgttcttcgtgatggagttcctcaacggg
ggagacctgatgtaccacatccaggacaaaggccgctttgagctatatcgtgccacgttt
tatgcggctgagatagtctgtggactacagtttctacatgacaaagggatcatttacagg
gacctcaagctggacaacgtgatgctggaccgggatggccacatcaaaattgctgacttc
gggatgtgcaaggagaacataactggggagaaacaggccagcaccttctgcggcactcct
gactatatcgcacctgagatcctacaaggcctgaagtactcgttctctgtggactggtgg
tcctttggagtccttctctacgagatgctcattggtcagtcccccttccacggtgacgat
gaggacgaactcttcgagtccatccgtgtggacaccccacattatccacgctggatcact
aaggagtccaaggatatcctggagaagctgcttgaaagggatccagccaagaggctggga
gtgactggcaacatcaaaacccaccccttcttcaagaccatcaactggactctgctggag
aaacgtctggtggagccacccttcaagcccaaagtgaagtcccctggagactacagcaac
tttgaccaggagttcctcaatgagaaggcgcgtctctcctacagtgacaagaacctcatc
gactccatggaccaaacagcattcgctggcttctccttcgtgaatcccaaatttgagagg
ctcctggaaaagtga

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107519569
Entry
107519569         CDS       T06036                                 

Gene name
PRKCH
Definition
(RefSeq) protein kinase C eta type
  KO
K18051  novel protein kinase C eta type [EC:2.7.11.13]
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04270  Vascular smooth muscle contraction
ray04750  Inflammatory mediator regulation of TRP channels
Brite
KEGG Orthology (KO) [BR:ray00001]
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    107519569 (PRKCH)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    107519569 (PRKCH)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ray01001]
    107519569 (PRKCH)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ray04147]
    107519569 (PRKCH)
Enzymes [BR:ray01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.13  protein kinase C
     107519569 (PRKCH)
Protein kinases [BR:ray01001]
 Serine/threonine kinases: AGC group
  PKC family [OT]
   107519569 (PRKCH)
Exosome [BR:ray04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   107519569 (PRKCH)
SSDB
Motif
Pfam: C1_1 Pkinase C2 PK_Tyr_Ser-Thr C1_2
Other DBs
NCBI-GeneID: 107519569
NCBI-ProteinID: XP_016017861
LinkDB
Position
Unknown
AA seq 478 aa
MSSGTMKFNGYLRVRIGEAVGLQPTRWSLRHSLFKKGYQLLDPYLTVSVDQVRVGQTSTK
QKTNKPTYNEEFCANVTDGGHLELAVFHETPLGYDHFVANCTLQFHELLRTAGASDTFEG
WVDLEPEGKVFVVITLTGSFTEATLQRDRIFKHFTRKRQRAMRRRVHQINGHKFMATYLR
QPTYCSHCREFIWGVFGKQGYQCQVCTCVVHKRCHHLIVTACTCQNNINKVDSKIAEQRF
GINIPHKFSIHNYKVPTFCDHCGSLLWGIMRQGLQCKICKMNVHIRCQANVAPNCGVNAV
ELAKTLAGMGLQPGNISPTSKLVSRSTLRRQGKESTKEGNGVGVNSSNRFGIDNFEFIRV
LGKGSFGKVMLARIKETGDLYAVKVLKKDVILQDDDVECTMTEKRILSLARNHPFLTQLF
CCFQTPDRLFFVMEFVNGGDLMFHIQKSRRFDEARARFYAAEIISALMFLHEKGIIYR
NT seq 1437 nt   +upstreamnt  +downstreamnt
atgtcgtctggcaccatgaagttcaatggctacttgagggtccgcatcggcgaagccgtg
gggctgcagcccactcgctggtccctgcgccactcgctcttcaagaagggctaccagctg
ctggatccctacctgacagtgagtgtggaccaggtgcgtgtgggccagaccagcaccaag
caaaagaccaacaaacccacgtacaatgaggagttctgcgctaacgtcaccgacggcggc
cacctcgagctggccgtcttccacgagacacccctgggctacgaccacttcgtggccaac
tgcaccctgcaattccacgagctgctgcgcaccgccggcgcctcggacaccttcgagggc
tgggtggatctggagccagaagggaaagtatttgtagtaataaccctaacaggaagtttc
actgaagctaccctccagagagaccggatcttcaaacattttaccaggaagcgccaaagg
gcaatgcgaaggcgagtccaccagatcaatggacacaagtttatggctacatacctgagg
cagcccacctactgctctcactgcagggaattcatctggggagtatttgggaaacagggt
tatcaatgccaagtgtgcacctgtgtcgtccataagcgctgccatcatctaattgttaca
gcctgcacttgccaaaacaatattaacaaagtggattcaaagattgctgaacagaggttt
ggaatcaacatcccacacaagttcagcatccacaactacaaagtgccaacattctgcgat
cactgtggctccctgctctgggggataatgcgacaaggacttcagtgtaaaatatgtaaa
atgaatgtacacatccgatgtcaggcaaacgtggctcctaactgtggggtgaacgcagtg
gaactagccaagactctggctgggatgggcctccaacccggaaatatttctccaacctcg
aagctcgtttccagatcgactctaagacgacagggaaaggagagcaccaaagaaggaaat
ggggtgggggttaattcttccaaccgatttggtatcgacaactttgagttcatccgcgtg
ttggggaagggaagctttgggaaggtgatgctcgcaagaataaaagaaacaggagacctc
tatgccgtgaaggtgctaaagaaggacgtgatcctgcaggatgacgatgtggagtgcaca
atgactgagaaaaggatcctgtccttggcacgcaatcaccccttcctcactcagttgttc
tgctgctttcagacccctgatcgtctgtttttcgtgatggaatttgtgaatgggggcgac
ttgatgtttcacattcagaagtctcgccgttttgatgaagcacgagctcgtttctatgct
gcggaaatcatttcggcgctcatgttcctacacgagaaaggcatcatctacaggtga

DBGET integrated database retrieval system