KEGG   Rousettus aegyptiacus (Egyptian rousette): 107503135
Entry
107503135         CDS       T06036                                 

Gene name
PLCL1
Definition
(RefSeq) inactive phospholipase C-like protein 1
  KO
K15375  inactive phospholipase C-like protein 1
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04727  GABAergic synapse
Brite
KEGG Orthology (KO) [BR:ray00001]
 09150 Organismal Systems
  09156 Nervous system
   04727 GABAergic synapse
    107503135 (PLCL1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:ray01009]
    107503135 (PLCL1)
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:ray04990]
    107503135 (PLCL1)
Protein phosphatases and associated proteins [BR:ray01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     107503135 (PLCL1)
Domain-containing proteins not elsewhere classified [BR:ray04990]
 Pleckstrin homology (PH) domain-containing proteins
  Other PH domain-containing proteins
   107503135 (PLCL1)
SSDB
Motif
Pfam: PI-PLC-X PI-PLC-Y PH_12 C2 EF-hand_like PH_14 EF-hand_7 PH
Other DBs
NCBI-GeneID: 107503135
NCBI-ProteinID: XP_015986520
LinkDB
Position
Unknown
AA seq 1123 aa
MSTLVPSGWTPLPGVQSRLGKPETRPAMAEGAAGREGLAPPDVVGGEDDPRVGSDGASGD
SVAAAPGGRSRDRRSGVVLPVAAGTPADIDAGLLEAARATPRRSSIIKDPSNQKCGGRKK
TVSFSSMPSEKKISSASDCISFMQAGCELKKVRPNSRIYNRFFTLDTDLQALRWEPSKKD
LDKAKLDISAIKEIRLGKNTETFRNNGLADQICEDCAFSILHGENYESLDLVANSADVAN
IWVSGLRYMVSRSKQPLDFEEGNQNTPRFMWLKTVFEAADVDGNGIMLEDTAVELIKQLN
PTLKESKIRLKFKEIQKSKEKLTTRVTEEEFCEAFCELCTRPEVYFLLVQISKNKEYLDA
NDLMLFLEAEQGVTHITEDMCLDIIRRYELSEEGRQKGFLAIDGFTQYLLSPECDIFDPE
QKKVAQDMTQPLSHYYINASHNTYLIEDQYRGPADINGYVRALKMGCRSIELDVSDGSDN
EPILCNRNNMTTYLSFRSVIEVINKFAFVASEYPLVLCLGNHCSLPQQKVMVQQMKKVFG
NKLYTEAPLPSESYLPSPEKLKRMIVVKGKKLPSDSDVLEGEVTDEDEEAEMSRRMSVDY
NGEQKQIWLCRELSDLVSICKSVQYRDFELSMKSQNYWEICSFSETEASRIANEYPEDFV
NYNKKFLSRIYPSAMRIDSSNLNPQDFWNCGCQIVAMNFQTPGPMMDLHTGWFLQNGGCG
YVLRPSIMRDEVSYFSANTKGIVPGVSPLALHIKIISGQNFPKPKGACAKGDVIDPYVCI
EIHGIPADCSEQRTKTVQQNSDNPIFDETFEFQVNLPELAMIRFVVLDDDYIGDEFIGQY
TIPFECLQPGYRHVPLRSFVGDVMEHVTLFVHIAITNRSGGGKAQKRSLSVRMGKKVREY
TMLRNIGLKTIDDIFKIAVHPLREAIDMRENMQNAIVSIKELCGLPPIASLKQCLLTLSS
RLITSDNTPSVSLVMKDNFPYLEALGAIPDVQKKMLAAYDLMIQESRFLIEMADTVQEKI
VQCQKAGMEFHEELHNLGAKEGLKGRKLNKATESFAWNITVLKGQGDLLKNAKNEAIENM
KQIQLACLSCGLSKGPSSSAETKSKRSLEAIEEKESGEENGKL
NT seq 3372 nt   +upstreamnt  +downstreamnt
atgagcacactggtgcccagcggctggactccgctgccgggcgtgcagtctcgcctcgga
aagcctgaaacgcgcccagccatggccgagggcgcggccggcagggagggtctcgcaccg
cccgacgtagtcgggggcgaagacgacccccgagtgggctcggatggcgcctccggggac
agcgtggcggcggcccctgggggccgatcgagggaccgtcgcagcggggtcgtattgccg
gtcgctgcagggacccccgcagacatcgacgctggccttttggaggcggcgcgggcgacc
ccccggcgcagcagcatcatcaaggatccttcaaaccaaaaatgtggtggaagaaagaaa
accgtgtctttcagcagcatgccgtcagaaaagaaaattagcagtgcgagcgactgcatc
agcttcatgcaagctggctgtgaactgaagaaagtccggccaaactctcgcatttacaac
cgtttttttactctggacacagacctccaggccctccgctgggaaccttccaagaaagac
cttgataaagctaagcttgatatttccgccataaaagagatcagactggggaagaacacg
gaaacatttagaaacaatggccttgctgaccagatttgtgaggactgtgccttttccata
ctccatggggaaaactacgagtctttagacctagttgccaattcagcggatgttgcaaac
atctgggtgtccgggttacggtacatggtttctcgaagtaagcaaccccttgattttgag
gagggcaaccagaacacaccaagattcatgtggttgaaaacagtgtttgaagcggcagac
gttgatgggaatggaattatgttggaagacactgctgtagagttaataaaacaactcaac
cctaccttgaaggaatccaagatcaggttaaagtttaaagaaatccagaagagcaaagaa
aagctaaccacccgtgtgacagaagaggaattttgtgaagctttttgtgaactttgcacc
aggccagaagtgtatttcttacttgtacagatatctaaaaacaaagaatatttggatgct
aatgatctaatgctatttttagaagctgagcaaggagtcacccatattaccgaagatatg
tgcttagacattattcggagatatgaactttctgaagagggacgtcaaaaggggtttctt
gcaattgatggctttacccagtatttgttgtcaccagaatgtgacatttttgaccctgag
caaaaaaaggttgcccaagatatgacccagccattatctcactactatatcaatgcctct
cacaacacctatctcatagaagaccaatacagggggccagctgatattaatgggtatgtt
cgagctttgaaaatgggctgtcgaagcattgaacttgatgtaagtgatggttcagacaat
gaaccaatcctttgtaatcgaaataacatgacaacatacctttcttttcgaagcgtcata
gaggtgataaataaatttgcctttgtggcttctgaatacccactcgttctttgcttgggg
aatcactgctctctaccacagcagaaggtaatggttcaacagatgaaaaaggtctttggc
aataaactctatactgaagcacctttgccatcagaatcctacctcccatcaccagaaaag
ttaaaaagaatgattgttgtgaaagggaagaaattgccttctgattcagatgttttagaa
ggagaagtaacagatgaagatgaagaagctgaaatgtctcgaaggatgtcagtagattac
aatggagagcagaaacaaatctggctgtgtagggagctttctgatttggtatctatttgt
aaatctgttcaatacagggatttcgaactgtccatgaagagtcaaaactactgggaaatt
tgttcatttagtgaaacagaggccagccgaattgcaaatgaatacccagaggattttgta
aattataataagaagttcttatcaagaatctatccgagtgccatgaggattgattccagt
aacttgaatccacaggacttttggaattgtggttgtcagattgtggcaatgaattttcag
actccaggtccaatgatggaccttcacacaggctggtttcttcaaaatggaggatgtggt
tatgttctaaggccgtctatcatgcgggatgaagtttcttacttcagcgcaaatacaaag
ggcattgtacctggggtgtctcctctagctcttcatatcaagatcatcagtggtcagaat
tttccaaagcccaagggagcttgtgccaaaggggatgtcatagatccctatgtttgtata
gagatacatggaataccagcagactgttcagagcaaagaactaaaactgtacaacaaaac
agtgataatcctatttttgatgaaacttttgagtttcaagtcaacctgcctgagctggcc
atgatccgttttgtcgttctggatgatgactacattggggatgagtttatagggcaatat
acaataccatttgagtgtttgcagcctggatatcggcatgttcccctgcgctcttttgtg
ggtgacgtcatggaacacgtaaccctttttgtccacattgcaataactaatcgaagtgga
ggaggaaaggcacagaagcgcagcctttcagtgagaatggggaagaaagtgcgagaatat
accatgctcaggaatattggtcttaaaaccatagatgacatctttaaaatagcagttcat
cccttacgagaagccatagatatgagagaaaatatgcagaatgccatagtgtctattaag
gaactgtgtggacttcctccaattgccagtctgaagcagtgcctgttgactctgtcctct
cggctcatcaccagtgacaatactccctcagtctctcttgtgatgaaagacaactttcct
tatctggaggctctgggggcaattccagatgtgcagaaaaagatgctggctgcttatgat
ctgatgattcaagagagccggtttctcatagaaatggctgacacagtccaggaaaagatt
gtgcagtgtcagaaagcagggatggagttccatgaggaacttcataatttgggagcaaaa
gaaggcttgaaaggaagaaaactcaataaggcaactgagagctttgcttggaatattaca
gtattgaagggtcaaggagatctgctgaagaatgcaaagaatgaagctatagaaaacatg
aagcagatccagctggcatgcttgtcttgtggacttagtaaaggccccagcagcagtgcc
gagaccaaaagcaagcgcagcctggaagccattgaggagaaggaaagcggtgaggagaat
ggaaagctgtga

DBGET integrated database retrieval system