KEGG   Rousettus aegyptiacus (Egyptian rousette): 107503153
Entry
107503153         CDS       T06036                                 

Gene name
TRAK2
Definition
(RefSeq) trafficking kinesin-binding protein 2 isoform X1
  KO
K15374  trafficking kinesin-binding protein 2
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray01100  Metabolic pathways
ray04727  GABAergic synapse
Brite
KEGG Orthology (KO) [BR:ray00001]
 09150 Organismal Systems
  09156 Nervous system
   04727 GABAergic synapse
    107503153 (TRAK2)
SSDB
Motif
Pfam: HAP1_N Milton Spc29 DUF2937 Spc7
Other DBs
NCBI-GeneID: 107503153
NCBI-ProteinID: XP_015986559
LinkDB
Position
Unknown
AA seq 913 aa
MNQSQNAIFTSPMGEENLMNSNPRDSESITDVCSNEDLPEVELVSLLEEQLPQYRLRVDS
LFLYENQDWTQSPQQQQHASDALSPVLAEETFRYMILGTDRVEQMTKTYNDIDMVTHLLA
ERDRDLELAAQIGQALLKRNHVLSEQNEALEEQLGQAFDQVNQLQHELSKKDELLRIVSI
ASEESETDSSCSTPLRFNESFSLSQGLLQLDMLQEKLKELEEENMVLRSKACHIKTETIT
YEEKEQQLVSDCVKELRETNAQMSKMTEELSGKSDELIRYQEEISSLLSQIVDLQHKLKE
HVIEKEELRLHLQASKDAQRQLTMELHELQDRNMECLGMLHESQEEIKELRSRSGPAAHL
YSQSCGAFSGESLAAEIEGTMRKKLSLDEESLFKQKAQQKRVFDTVRIANDTRGRSVPFP
ALLTIPGSNRSSVIMTAKPFESGLQQTKDKTLLSQGSNSEAVPGNIQKVGQPEPSEDSDL
ATALHRLSLRRQNYLSEKQFFAEEWERKIQVLADQKEGVSGRGTPTESLASLCTDQSEIT
DFSSASCLRCFMPEKLQIVKPLEGSQTLYHWQQLAQPNLGTILDPRPGVITKGFTQLPKD
AIYHLSDLEEDEEEGITFQVQQPLQVEQKPTDSKPVTGIFLPPITSAGGPVTVATSNPGK
CLSCTNLTFTFTTCRILHPSDITQVTPSSGFPSLSCGSSSSSSSNTVVNSPAMSYRLSIG
ESITNRRDSTITFSSTVSLAKLLQERGISAKVYHSPVSEKPLLQSLPKALAIPSTPPNSP
SHSPCSSPVPFEPRVHLSENFLASRPAETFLQEMYGLRPSRSPPDTGQLKMNLVGRLKRL
GIARVIKAPDAQENGRSQEAETGLQRPESAVYLNSGSNLLSGLRRNQSLPIMMGSFGNSV
CTSSPKMGILKED
NT seq 2742 nt   +upstreamnt  +downstreamnt
atgaatcagtcccagaatgccatttttacatcgccaatgggtgaagaaaacctcatgaat
agcaatcccagagattcagagagcatcactgatgtctgctccaatgaggatctgcctgaa
gttgagctggtgagtctgctagaagaacagctaccccagtacaggctaagagtggactct
ctctttctctatgaaaatcaagactggactcagtccccacagcagcagcagcatgcatct
gatgccctttctcccgtccttgctgaagagactttccgttatatgattctaggcacagac
agggtggagcagatgaccaaaacttacaatgacatcgacatggttacacatctcctggca
gagagggatcgtgatctggagctagcggctcaaattgggcaagctctcttaaagcggaac
catgtcttgtctgagcagaatgaagcccttgaggagcagttggggcaagcttttgatcaa
gttaatcaactacaacatgagctatccaagaaagatgagttacttcgaattgtctccatt
gcttctgaagagagtgaaactgattccagctgttctacaccccttcggtttaatgagtcc
tttagcttatcacagggtttgctgcagttggacatgctgcaggaaaagctcaaggaactg
gaagaagagaatatggttcttcgatccaaggcttgtcacataaagacagaaactattacc
tacgaagagaaggaacaacagcttgtcagcgactgtgttaaagaacttcgcgaaactaat
gctcagatgtctaaaatgactgaagaattgtctgggaagagtgatgaactgattcgatac
caagaagagatctcttctctcttgtctcagattgtagatcttcagcacaaacttaaagaa
catgtgattgagaaggaagaactgagacttcatctacaagcttctaaagatgcccaaaga
caactgacaatggagctgcatgagttacaagacaggaatatggagtgtctgggaatgtta
catgaatcccaggaagaaataaaggaacttcgtagtagatctggccctgctgctcatctg
tactcccagtcatgtggagctttttctggagaatctttagcagctgagattgagggaacc
atgcgtaaaaagttgagtttggatgaggaatctctctttaaacaaaaagcccaacagaaa
cgggtatttgatactgtcaggattgccaatgacacacggggccgctctgtcccattccca
gctctgctaacgattccaggctccaatcgttcaagtgtcatcatgacagcaaaacctttt
gagtcaggtttacaacaaacaaaggacaaaacacttctgagccaggggagcaactcggag
gcagttccagggaacattcagaaggtgggtcaaccagaaccctccgaagacagtgatttg
gctacagcactgcatcgccttagtctgcggcgacagaactacttaagtgagaagcagttc
tttgctgaagagtgggagcggaagattcaggtcttggctgaccagaaagaaggggttagt
ggccgtggcacccccacagagagccttgcctctctctgtaccgaccagtcggagatcaca
gacttcagcagcgccagttgccttcggtgttttatgcctgaaaaattacaaattgtcaag
ccccttgaaggatcacaaactctgtaccactggcagcagcttgctcaaccaaatttagga
accattcttgacccacgaccaggtgtcatcactaaaggctttacccagttgcctaaggac
gccatctatcacctctcagatttagaagaggatgaagaggaaggtatcacttttcaggtt
cagcaacctcttcaagtggaacaaaaacctacagattccaagccagtaacaggaatcttt
ctgccacccattacttcagcaggtggtccagttacagttgcaacctcaaacccagggaag
tgtctctcatgcacaaacttgacattcaccttcaccacctgtaggatattacatccctct
gatatcactcaggttacccccagctctgggttcccttccttatcctgtggaagtagcagt
agcagttcatcaaacacggtggtgaattctcctgctatgtcctatagactcagcattggt
gagtccatcaccaaccgacgagattccacaataaccttcagcagcaccgtgagcttggcc
aaacttctccaagagcgaggcatctctgctaaagtctaccacagccccgtttcagagaag
ccccttctccagtctctccctaaagccctggctatcccttccacaccaccaaattcacca
tctcactcaccttgctcttctcctgtgccctttgagcctcgagtgcatctctctgaaaat
tttttggcctcccgcccagccgaaacattcctccaggagatgtatggcttgagaccttct
cggagccctcctgatactggccagctgaagatgaacttagtgggcaggctgaagagactg
gggatagccagagtgatcaaggcccccgatgcccaggaaaatggaagaagccaagaggca
gaaactggtcttcaaagaccagagtctgctgtttacttaaattcaggtagcaacttattg
agtggattgaggaggaatcagagtctaccaatcatgatgggtagctttggcaactcagtt
tgcacatcctcacccaaaatgggtatcctgaaggaggactga

DBGET integrated database retrieval system