KEGG   Rousettus aegyptiacus (Egyptian rousette): 107503155
Entry
107503155         CDS       T06036                                 

Gene name
CASP8
Definition
(RefSeq) caspase-8 isoform X1
  KO
K04398  caspase 8 [EC:3.4.22.61]
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray01524  Platinum drug resistance
ray04115  p53 signaling pathway
ray04210  Apoptosis
ray04215  Apoptosis - multiple species
ray04217  Necroptosis
ray04620  Toll-like receptor signaling pathway
ray04621  NOD-like receptor signaling pathway
ray04622  RIG-I-like receptor signaling pathway
ray04625  C-type lectin receptor signaling pathway
ray04657  IL-17 signaling pathway
ray04668  TNF signaling pathway
ray04932  Non-alcoholic fatty liver disease
ray05010  Alzheimer disease
ray05016  Huntington disease
ray05022  Pathways of neurodegeneration - multiple diseases
ray05132  Salmonella infection
ray05134  Legionellosis
ray05142  Chagas disease
ray05145  Toxoplasmosis
ray05152  Tuberculosis
ray05160  Hepatitis C
ray05161  Hepatitis B
ray05162  Measles
ray05163  Human cytomegalovirus infection
ray05164  Influenza A
ray05165  Human papillomavirus infection
ray05167  Kaposi sarcoma-associated herpesvirus infection
ray05168  Herpes simplex virus 1 infection
ray05169  Epstein-Barr virus infection
ray05170  Human immunodeficiency virus 1 infection
ray05200  Pathways in cancer
ray05203  Viral carcinogenesis
ray05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    107503155 (CASP8)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    107503155 (CASP8)
   04215 Apoptosis - multiple species
    107503155 (CASP8)
   04217 Necroptosis
    107503155 (CASP8)
   04115 p53 signaling pathway
    107503155 (CASP8)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    107503155 (CASP8)
   04621 NOD-like receptor signaling pathway
    107503155 (CASP8)
   04622 RIG-I-like receptor signaling pathway
    107503155 (CASP8)
   04625 C-type lectin receptor signaling pathway
    107503155 (CASP8)
   04657 IL-17 signaling pathway
    107503155 (CASP8)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107503155 (CASP8)
   05203 Viral carcinogenesis
    107503155 (CASP8)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    107503155 (CASP8)
   05016 Huntington disease
    107503155 (CASP8)
   05022 Pathways of neurodegeneration - multiple diseases
    107503155 (CASP8)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    107503155 (CASP8)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    107503155 (CASP8)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107503155 (CASP8)
   05134 Legionellosis
    107503155 (CASP8)
   05152 Tuberculosis
    107503155 (CASP8)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    107503155 (CASP8)
   05161 Hepatitis B
    107503155 (CASP8)
   05160 Hepatitis C
    107503155 (CASP8)
   05164 Influenza A
    107503155 (CASP8)
   05162 Measles
    107503155 (CASP8)
   05168 Herpes simplex virus 1 infection
    107503155 (CASP8)
   05163 Human cytomegalovirus infection
    107503155 (CASP8)
   05167 Kaposi sarcoma-associated herpesvirus infection
    107503155 (CASP8)
   05169 Epstein-Barr virus infection
    107503155 (CASP8)
   05165 Human papillomavirus infection
    107503155 (CASP8)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    107503155 (CASP8)
   05142 Chagas disease
    107503155 (CASP8)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    107503155 (CASP8)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:ray01002]
    107503155 (CASP8)
Enzymes [BR:ray01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.61  caspase-8
     107503155 (CASP8)
Peptidases and inhibitors [BR:ray01002]
 Cysteine peptidases
  Family C14: caspase family
   107503155 (CASP8)
SSDB
Motif
Pfam: Peptidase_C14 DED PYRIN
Other DBs
NCBI-GeneID: 107503155
NCBI-ProteinID: XP_015986564
LinkDB
Position
Unknown
AA seq 483 aa
MNFSNCLYDIGENLGSDELASLKFLSVDHIPQKKQEPIKDALMLFQILQEKSMLEESDFF
FLKELLFRINRLDLLVNHLGSSEEEMIKELQIPGKAKISAYRVMLFQISEDVNKQELKAF
KFLLNKEIAKCKLDDDMTLLDIFIEMEKRVILGERNLDILKRICDQVNKSLLKKISAYEE
ELSRVSSQPCLIPDVSQPYAEELSCEMLSMSDSPGEQNCESQEQTSDKVYRMKSKPRGYC
LIFNNYDFSEARKAVPKLHSMKDRNGTDLDEEALSETFKELHFKINPFKNCTAKEICDHL
KTYQSIDHKNMDCFICCILSHGDKGIIYGCDGQEVPIYELTSYFTGSNCPSLVGKPKIFF
IQACQGDNYQRGIAVETDSEECESYLEMDSSFQKKYIPDEADFLLGMATVNNCVSYRNPL
EGTWYIQSLCQSLREKCPRGEDILTILTEVNFEVSRKDDKKKMGKQMPQPTFTLRKKLFF
PLN
NT seq 1452 nt   +upstreamnt  +downstreamnt
atgaatttcagcaattgcctctatgatattggggaaaatcttggcagtgatgagctggcc
tccctcaagttcctgagcgtggaccacatcccacaaaagaagcaggaacccatcaaggat
gccttaatgttattccagatacttcaggaaaaaagcatgttggaggaaagcgactttttt
ttcttgaaggagctgctattccgaattaatagactggatttgctggtcaaccacctaggc
agcagtgaagaagagatgataaaggagcttcagataccgggcaaggctaagatctctgcc
tacagggtcatgctttttcagatttctgaagatgtaaacaagcaggaattgaaggccttt
aagtttcttttgaacaaggaaattgccaaatgtaaactggatgatgacatgaccttgctt
gatattttcatagagatggagaagagggttatacttggggaaagaaatttggacatcctg
aaaagaatctgcgaccaagtcaataagagcctgctgaagaaaatcagtgcttatgaagaa
gaattaagcagagtatcttcccagccatgtctcattccagatgtgtctcaaccgtatgca
gaggagttgtcatgtgagatgctgtcaatgtcggactcaccaggagaacagaactgtgaa
tcacaagaacagacatcggacaaagtttaccgaatgaaaagcaagcctcgcgggtactgt
ttgatatttaacaattacgattttagcgaagcacggaaggctgtgcccaaacttcacagc
atgaaggatagaaatggaacagacttggatgaagaggctttgagtgaaacctttaaagaa
cttcattttaagataaatcctttcaaaaactgcacagcaaaggaaatctgtgatcatctg
aaaacctatcaaagcatagaccacaaaaacatggactgcttcatctgctgcatcctctcc
catggagacaagggcattatttatggctgtgatgggcaggaagtccccatctatgagctg
acctcttacttcaccggttcgaattgcccttcccttgtaggcaaacccaaaatctttttt
attcaggcttgtcaaggggataactaccagagaggtatagctgttgagactgattcagaa
gagtgcgaaagctatttagaaatggattcatcatttcaaaagaaatatatccctgatgag
gctgactttctgctaggaatggccactgtgaacaactgtgtttcctaccgaaaccccctg
gaggggacctggtatattcagtcgctctgtcagagcctgagagaaaaatgtcctaggggt
gaagatattcttaccatcctcactgaggtgaactttgaagtgagcagaaaggatgacaag
aaaaaaatgggcaagcagatgccacagcctacttttaccctgagaaaaaaactttttttc
cctctgaattga

DBGET integrated database retrieval system