KEGG   Rousettus aegyptiacus (Egyptian rousette): 107503177
Entry
107503177         CDS       T06036                                 

Gene name
KCNQ1
Definition
(RefSeq) LOW QUALITY PROTEIN: potassium voltage-gated channel subfamily KQT member 1
  KO
K04926  potassium voltage-gated channel KQT-like subfamily member 1
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04261  Adrenergic signaling in cardiomyocytes
ray04725  Cholinergic synapse
ray04971  Gastric acid secretion
ray04972  Pancreatic secretion
ray04974  Protein digestion and absorption
Brite
KEGG Orthology (KO) [BR:ray00001]
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107503177 (KCNQ1)
  09154 Digestive system
   04971 Gastric acid secretion
    107503177 (KCNQ1)
   04972 Pancreatic secretion
    107503177 (KCNQ1)
   04974 Protein digestion and absorption
    107503177 (KCNQ1)
  09156 Nervous system
   04725 Cholinergic synapse
    107503177 (KCNQ1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:ray04040]
    107503177 (KCNQ1)
Ion channels [BR:ray04040]
 Voltage-gated cation channels
  Potassium channel, voltage-gated (Kv)
   107503177 (KCNQ1)
SSDB
Motif
Pfam: KCNQ_channel Ion_trans Ion_trans_2 WDCP ATPase_2 PsbW
Other DBs
NCBI-GeneID: 107503177
NCBI-ProteinID: XP_015986615
LinkDB
Position
Unknown
AA seq 651 aa
MAAASSPPRAERKRWGWGRLPGARRGSAGLAKKCPFSLELAEDHPAPGAPPAADLDPRPR
MSLDPRVSIYSARRPLLARTHVQGRVYNFLERPTGWKCFVYHFAVFLIVLACLIFSVLST
IEQYVALATGTLFWMEIVLVVFFGTEYVVRLWSAGCRSKYVGIWGRLRFARKPISIIDLI
VVVASMVVLCVGSKGQVFATSAIRGIRFLQILRMLHVDRQGGTWRLLGSVVFIHRQELIT
TLYIGFLGLIFSSYFVYLAEKDAVDESGRVEFGSYADALWWGVVTVTTIGYGDKVPQTWV
GKTIASCFSVFAISFFALPAGILGSGFALKVQQKQRQKHFNRQIPAAASLIQTAWRCYAA
ENPDSATWKIYVRKPSRGHSLPSPSPKPKKSAMVKKKKFKLDKDNGVSPGEKMLTVPQIT
CDHVSDERRSDHFSVDYYDSSGKKSPMLLEVSTPQFVRTNSFTEDLDLEGETLLAPITHV
SQLREHHRATIRVVRRMQYFVAKKRFQQARKPYDVRDVIEQYSQGHLNLMVRIKELQRRL
DQSIGKPSLFIAVSEKSKDRGSNTIGARLHRVEDKVTQLDQRLVLITDMLQQLLSLNQDG
PPGGQPPSGSGAHVARPCXESSINPELFLPSSALPTYEQLTVPRRGPDEGS
NT seq 1956 nt   +upstreamnt  +downstreamnt
atggccgcggcctcctccccgccccgggcggagaggaagcgctggggctggggccgtctg
cccggcgcccggaggggcagcgcgggcctggccaagaagtgccccttctcgctggagctg
gccgaggaccacccggcgcccggcgcgccgcccgccgccgacctcgacccgcggccgcgc
atgagcctcgacccgcgcgtgtccatctacagcgcgcgccgcccgctgctcgcgcgcacc
cacgtccagggccgcgtctacaacttcctggagcgccccaccggctggaagtgcttcgtc
taccacttcgccgtcttcctcatcgtcctggcctgcctcatcttcagcgtgctgtccacc
atcgagcagtatgtagcactggccacgggcaccctcttctggatggagatcgtcctggtg
gtgttcttcgggacggagtacgtggtgcggctctggtcggccggctgccgcagcaagtac
gtgggcatctggggccggctgcgcttcgcccggaagcccatctccatcatcgacctcatc
gtggtcgtggcctccatggtggttctctgcgtgggctccaaggggcaggtgtttgccacc
tcggccatcaggggcatccgcttcctgcagatcctgcgcatgctgcacgtggaccgccag
ggcggtacctggaggctgctgggctccgtggtcttcatccatcgccaggagctgatcacc
acactgtacatcggcttcctgggcctcatcttctcctcctacttcgtgtacctggccgag
aaggacgccgtggacgagtcgggccgcgtggagttcggcagctacgcagacgccctgtgg
tggggtgtggtcacggtcaccaccatcggctacggggacaaggtgccgcagacctgggtc
gggaagaccatcgcctcctgcttctccgtcttcgccatctccttcttcgcgctcccagcg
ggcatcctcggctccggcttcgccctgaaggtccagcagaagcagagacagaagcacttc
aaccggcagatcccggcggcggcctcgctcattcagacagcatggcggtgctacgccgca
gagaaccccgactcggccacctggaaaatctacgtgcggaagccgtcccggggccactct
ctgccgtcccccagccccaagcccaagaagtccgccatggtaaagaaaaaaaagttcaaa
ctggacaaggacaacggggtgagtccaggggagaagatgctcacggtcccccagatcacg
tgcgaccacgtctccgacgagcggaggtcggaccacttctccgtggactattatgacagt
tccgggaagaagagccccatgctgctggaggtgagcacgccccagttcgtgagaaccaac
agcttcaccgaggacctggacctggagggcgagacgctgctggcgcccatcacccacgtg
tcacagctgcgggagcaccatcgagccaccatcagggtcgtccggcgcatgcagtacttt
gtggccaagaagaggtttcagcaagcccggaagccctacgacgtgcgggacgtcatcgag
cagtactcccaaggccacctcaacctcatggtgcgcatcaaggagctacagagaaggctg
gaccagtccatcgggaagccctccctcttcatcgctgtctcagagaagagcaaggaccgc
ggcagcaacaccatcggcgcccgtctgcaccgggtggaggacaaggtgacacagctggac
cagaggctggtgctcatcacagacatgctccagcagctgctttcactgaaccaggacggc
cccccgggcggccagccccccagcgggagcggggcccacgtggcccggccctgcnncgag
agctccatcaaccccgagctcttcctgcccagcagcgccctgcccacctacgaacagctg
accgtcccccgcaggggtcccgacgaggggtcctga

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107520362
Entry
107520362         CDS       T06036                                 

Definition
(RefSeq) potassium voltage-gated channel subfamily E member 1-like
  KO
K04894  potassium voltage-gated channel Isk-related subfamily E member 1
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04261  Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:ray00001]
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107520362
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:ray04040]
    107520362
Ion channels [BR:ray04040]
 Voltage-gated cation channels
  Potassium channel, voltage-gated (Kv)
   107520362
SSDB
Motif
Pfam: ISK_Channel
Other DBs
NCBI-GeneID: 107520362
NCBI-ProteinID: XP_016019562
LinkDB
Position
Unknown
AA seq 129 aa
MVLPNTTAVTPFLTKLWQELAQPGVNGSGPVRRSPGDSDGKMEAVYILMVLGFFGFFTLG
IMLSYIRSKKLEHSHDPYSVYIQSDAWQEKDKAYFRARVLESYKACYVAANQLAVERPHT
FLPEMKPSP
NT seq 390 nt   +upstreamnt  +downstreamnt
atggtcctgccaaacaccacggccgtgacgccctttctgaccaagctgtggcaggagctg
gcgcagcctggcgtcaacgggtccggcccggtccgcaggtcccccggtgacagcgacggc
aagatggaggctgtctacatcctcatggtgctgggcttcttcgggttcttcaccctgggc
atcatgctgagctacatccgctccaagaagctggagcactcgcatgacccctacagcgtg
tacatccagtcggacgcctggcaagagaaagacaaggcgtacttccgggcccgggtcctg
gagagctacaaggcatgttacgtcgctgccaaccagctggccgtggaacggccccacacg
ttccttcccgagatgaagccttcaccgtga

DBGET integrated database retrieval system