KEGG   Rousettus aegyptiacus (Egyptian rousette): 107503251
Entry
107503251         CDS       T06036                                 

Gene name
GPHN
Definition
(RefSeq) gephyrin isoform X1
  KO
K15376  gephyrin [EC:2.10.1.1 2.7.7.75]
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray00790  Folate biosynthesis
ray01100  Metabolic pathways
ray01240  Biosynthesis of cofactors
ray04727  GABAergic synapse
Module
ray_M00880  Molybdenum cofactor biosynthesis, GTP => molybdenum cofactor
Brite
KEGG Orthology (KO) [BR:ray00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    107503251 (GPHN)
 09150 Organismal Systems
  09156 Nervous system
   04727 GABAergic synapse
    107503251 (GPHN)
Enzymes [BR:ray01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.75  molybdopterin adenylyltransferase
     107503251 (GPHN)
  2.10  Transferring molybdenum- or tungsten-containing groups
   2.10.1  Molybdenumtransferases or tungstentransferases with sulfide groups as acceptors
    2.10.1.1  molybdopterin molybdotransferase
     107503251 (GPHN)
SSDB
Motif
Pfam: MoCF_biosynth MoeA_N MoeA_C Tubulin-binding
Other DBs
NCBI-GeneID: 107503251
NCBI-ProteinID: XP_015986707
LinkDB
Position
Unknown
AA seq 828 aa
MATEGMILTNHDHQIRVGVLTVSDSCFRNLAEDRSGINLKDLVQDPSLLGGTISAYKIVP
DEIEEIKETLIDWCDEKELNLILTTGGTGFAPRDVTPEKFPTFPFCGLQKGATKEVIERE
APGMALAMLMGSLNVTPLGMLSRPVCGIRGKTLIINLPGSKKGSQECFQFILPALPHAID
LLRDAIVKVKEVHDELEDLPSPPPPLSPPPTTSPHKQTEDKGVQCEEEEEEKKDSGVAST
EDSSSSHITAAAIAAKKHPFYTSPAVIMAHGEQPIPGLISYSHHATGSADERIPDSIISR
GVQVLPRDTASLSTTPSESPRAQATSRLSTASCPTPKQIRRPDESKGVASRVGSLKVQSR
CSSKENILRASHSAVDITKVARRHRMSPFPLTSMDKAFITVLEMTPVLGTEIINYRDGMG
RVLAQDVYAKDNLPPFPASVKDGYAVRAADGPGDRFIIGESQAGEQRTDSFLHVCFQPTQ
TVMPGQVMRVTTGAPIPCGADAVVQVEDTELIRESDDVRHHQVLLHIPATGTEELEVRIL
VQARPGQDIRPIGHDIKRGECVLAKGTHMGPSEIGLLATVGVTEVEVNKFPVVAVMSTGN
ELLNPEDDLLPGKIRDSNRSTLLATIQEHGYPTINLGIVGDNPDDLLNALNEGISRADVI
ITSGGVSMGEKDYLKQVLDIDLHAQIHFGRVFMKPGLPTTFATLDIDGVRKIIFALPGNP
VSAVVTCNLFVVPALRKMQGILDPRPTIIKARLSCDVKLDPRPEYHRCILTWHHQEPLPW
AQSTGNQMSSRLMSMRSANGLLMLPPKTEQYVELHKGEVVDVMVIGRL
NT seq 2487 nt   +upstreamnt  +downstreamnt
atggcgaccgagggaatgatcctcactaaccacgaccatcaaatccgtgtcggagtcctc
acagtgagtgatagttgcttcaggaatcttgcagaagatcgcagtgggataaatctcaaa
gatctcgtacaagatccttctttattgggtgggaccatatcagcatacaagatagtacca
gacgaaatagaagaaatcaaggaaaccctgatagattggtgtgatgaaaaggaacttaat
ttgatattaacaactggaggaacagggttcgcaccacgagatgtcactccagagaaattc
ccaacattcccattttgtgggctccagaaaggggccacaaaagaagtaatagaacgggaa
gcgccagggatggccctggcaatgctgatgggatcacttaatgttacacctctgggcatg
ctctctaggcctgtatgtggaatcagagggaaaacactcataattaacctgccaggtagc
aagaaaggatctcaggaatgctttcagttcatactgccagctctacctcatgccattgac
cttttacgtgatgccattgtaaaagtaaaggaagtgcatgatgaacttgaagatttacct
tccccgccacctcccctttcccctcctcccacaactagcccacataaacagacggaagac
aaaggggttcaatgtgaggaagaggaagaagagaagaaagacagtggggttgcttcaaca
gaagacagttcttcatcacatataactgcagcagccattgctgccaagaagcatccattc
tacaccagtcctgctgttatcatggcacacggtgagcagcccatccctggtctcatcagt
tattcccatcatgcaacaggcagtgcagatgaacggattccagactccatcatttctcgt
ggtgttcaggtgctcccaagagacacagcttccctcagcactactccttcagaatcgcct
cgtgctcaggctacatctcgcctttctacagcttcctgcccaacaccaaaacaaattaga
cggccggatgaaagcaaaggagttgctagtagagttggatccctcaaagtccagtccagg
tgcagcagcaaagagaacattctcagagccagtcacagtgctgttgatatcaccaaggtg
gctagaagacaccgcatgtctccttttcctctaacatctatggacaaagccttcatcaca
gtcctggagatgactccggtgcttgggacagaaattatcaactatcgagatggaatgggt
cgagttcttgctcaagatgtatatgcaaaagataacctaccccccttcccagcatcagta
aaagatggctatgctgttcgagctgctgatggcccaggagatcgtttcatcattggggaa
tctcaagctggtgaacagagaaccgattctttcctacatgtttgtttccagccaactcag
acagtgatgcctggacaagtcatgcgagttacaacaggtgctccaatcccctgcggtgct
gatgcagtagtacaagtagaagatactgaacttatcagggaatccgatgatgtacgtcat
caccaggtcttactgcacattcctgcgacgggcacagaggaacttgaagtaagaattctg
gtgcaagctcggccaggccaagatatcagacccatcggccatgacattaaaagaggggaa
tgtgttttggccaaaggaactcacatgggcccttcagagattggtcttctagcaactgta
ggtgttacagaggttgaagttaataagtttccagtggttgcagtcatgtctacagggaat
gagctgctaaatcctgaagatgacctcttgccaggaaagattcgagacagcaatcgttca
accctcttagccacaattcaggaacatggttaccccacaatcaacttgggaatcgtggga
gacaacccagatgacttacttaatgccttgaatgagggtatcagtcgtgcggatgtcatc
atcacatcagggggtgtgtccatgggggaaaaggactatctcaagcaggtgctggacatt
gatcttcatgctcagatccattttggcagggtttttatgaaaccaggcctaccaacaaca
tttgcaactttggatattgatggtgtaagaaaaataatatttgcactaccagggaatcct
gtgtcagccgtggtcacctgcaatctctttgttgtgcctgcactgagaaaaatgcagggc
atcttggatcctcggccaaccatcatcaaagccaggttatcatgtgatgtaaaactggat
cctcgcccagaataccatcggtgtatactgacttggcatcaccaagaaccactgccttgg
gcacagagtacaggtaatcagatgagcagccgtctgatgagcatgcgcagtgccaacgga
ctgttgatgctacctccaaagacagagcagtacgtggagctccacaagggcgaggtggtg
gatgtcatggtcattggacgactatga

DBGET integrated database retrieval system