KEGG   Rousettus aegyptiacus (Egyptian rousette): 107503262
Entry
107503262         CDS       T06036                                 

Gene name
SLC8A3
Definition
(RefSeq) sodium/calcium exchanger 3 isoform X1
  KO
K05849  solute carrier family 8 (sodium/calcium exchanger)
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04020  Calcium signaling pathway
ray04022  cGMP-PKG signaling pathway
ray04260  Cardiac muscle contraction
ray04261  Adrenergic signaling in cardiomyocytes
ray04371  Apelin signaling pathway
ray04740  Olfactory transduction
ray04961  Endocrine and other factor-regulated calcium reabsorption
ray04974  Protein digestion and absorption
ray04978  Mineral absorption
ray05410  Hypertrophic cardiomyopathy
ray05412  Arrhythmogenic right ventricular cardiomyopathy
ray05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    107503262 (SLC8A3)
   04020 Calcium signaling pathway
    107503262 (SLC8A3)
   04022 cGMP-PKG signaling pathway
    107503262 (SLC8A3)
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    107503262 (SLC8A3)
   04261 Adrenergic signaling in cardiomyocytes
    107503262 (SLC8A3)
  09154 Digestive system
   04974 Protein digestion and absorption
    107503262 (SLC8A3)
   04978 Mineral absorption
    107503262 (SLC8A3)
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    107503262 (SLC8A3)
  09157 Sensory system
   04740 Olfactory transduction
    107503262 (SLC8A3)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    107503262 (SLC8A3)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    107503262 (SLC8A3)
   05414 Dilated cardiomyopathy
    107503262 (SLC8A3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ray02000]
    107503262 (SLC8A3)
   00536 Glycosaminoglycan binding proteins [BR:ray00536]
    107503262 (SLC8A3)
Transporters [BR:ray02000]
 Solute carrier family (SLC)
  SLC8: Na+/Ca2+ exchanger
   107503262 (SLC8A3)
Glycosaminoglycan binding proteins [BR:ray00536]
 Heparan sulfate / Heparin
  Others
   107503262 (SLC8A3)
SSDB
Motif
Pfam: Calx-beta Na_Ca_ex Na_Ca_ex_C
Other DBs
NCBI-GeneID: 107503262
NCBI-ProteinID: XP_015986767
LinkDB
Position
Unknown
AA seq 928 aa
MAWLRLQPLTSAFLHFGLITFVLFLNGLRAEAGGSGDVPSTGQNNESCSGSSDCKEGVIL
PIWYPENPSLGDKIARVIVYFVALIYMFLGVSIIADRFMASIEVITSQEREVTIKKPNGE
TSTTTIRVWNETVSNLTLMALGSSAPEILLTLIEVCGHGFIAGDLGPSTVVGSAAFNMFI
IIGICVYVIPDGETRKIKHLRVFFVTAAWSIFAYIWLYMILAVFSPGVVQVWEGLLTLFF
FPVCVFLAWMADKRLLFYKYMHKKYRTDKHRGIIIETEGDHPKGIEMDGKMMNSHFLDGN
LVPLEGKEVDESRREMIRILKDLKQKHPEKDLDQLVEMANYYALSHQQKSRAFYRIQATR
MMTGAGNILKKHAAEQAKKSSSMSEVHTDEPEDFISKVFFDPCSYQCLENCGAVLLTVVR
KGGDMSKTMYVDYKTEDGSANAGADYEFTEGTVVLKPGETQKEFSVGIIDDDIFEEDEHF
FVRLSNVRIEEELPEEGMPPTLLNCLPLPRAVLVSPCVATVTILDDDHAGIFTFECDTIH
VSESVGIMEVKVLRTSGARGTVIVPFRTVEGTAKGGGEDFEDTYGELEFKNDETVKTIHI
KVIDDEEYEKNKNYFIELMGPRMVEMSFQKALLLSPEVTDRKLTMEEEEAKRIAEMGKPV
LGQHPKLEVIIEESYEFKSTVDKLIKKTNLALVVGTHSWRDQFMEAITVSAAGDEDEDES
GEERLPSCFDYVMHFLTVFWKVLFACVPPTEYCHGWACFIVSILIIGMLTAIIGDLASHF
GCTIGLKDSVTAVVFVAFGTSVPDTFASKAAAIQDVYADASIGNVTGSNAVNVFLGIGLA
WSVAAIYWAFQGQEFHVSAGTLAFSVTLFTIFAFVCISVLLYRRRPHLGGELGGPRGCKL
ATTWLFVSLWLLYILFASLEAYCYIKGF
NT seq 2787 nt   +upstreamnt  +downstreamnt
atggcgtggttaaggttacagcctctcacctctgccttccttcattttgggctgattact
tttgtgctcttcctgaatggtcttcgggcagaggctggtggctcaggggatgtgcccagc
acagggcagaacaatgagtcctgttcagggtcatcagactgcaaggagggtgtcatctta
ccaatctggtacccggagaacccttcccttggagacaagattgctagggtcattgtctat
tttgtggccctgatatacatgttccttggggtatccatcattgctgaccgcttcatggca
tctattgaagttatcacttctcaagagagagaggtgactatcaaaaagcccaatggagag
accagcacaacaacgattcgggtatggaacgaaactgtctccaacctgacccttatggcc
ctgggttcctctgctcctgagatccttctcactttaattgaggtgtgtggtcatgggttc
attgctggtgatctgggaccttctactgtcgtaggcagtgcagctttcaacatgtttatc
attattggcatctgtgtctacgtgattcctgatggagagactcgtaagatcaagcaccta
cgagtcttctttgtcaccgccgcttggagtatctttgcctacatctggctctatatgatc
ctggcagtcttctctcctggtgtggtccaggtttgggaaggcctcctcactctcttcttt
tttccagtatgtgtctttctggcctggatggccgataagcgactgctcttctacaaatac
atgcacaaaaagtatcgcacagataaacaccgaggaattatcattgagacagagggtgac
caccccaagggcattgagatggatggaaaaatgatgaattcccacttcttagatgggaac
ctggtgcccttggaagggaaggaagtggatgagtctcgcagggagatgatccggattctc
aaagatctgaagcaaaaacacccagaaaaggacttagatcagctcgtagagatggccaat
tactatgctctttcccatcaacagaagagccgcgccttctaccggatccaagccacccgt
atgatgactggcgcaggcaatatcctgaagaaacatgcagcagaacaagccaaaaagtcc
tccagcatgagtgaggtacacactgatgagcctgaggacttcatctccaaggtcttcttt
gacccatgctcttaccagtgcctagagaactgtggggctgtcctcctgacagtggtgagg
aaagggggggacatgtccaagaccatgtatgtggactataaaacagaggatggttctgcc
aatgcaggggctgactatgagttcacagagggcactgtggttctgaagccaggagagacc
cagaaggagttctccgtgggcatcattgatgatgacatttttgaggaggacgaacacttc
tttgtgaggttgagcaatgtccgcatagaggaggagctaccagaggaggggatgcctcca
acattactcaattgtcttcccttgcctcgggctgtcctggtgtctccttgtgtggccact
gtcactatcttggatgatgaccatgcaggcatcttcacttttgaatgtgacactattcat
gtcagtgagagtgttggtatcatggaggtgaaggttctgaggacatcaggtgcccggggc
acagtaatcgtcccctttaggacagtagaagggacagctaagggtggtggtgaggatttc
gaagacacgtatggggagttggagttcaagaatgatgagactgtcaaaacaattcacatc
aaggtaattgatgatgaggagtatgagaaaaacaagaattacttcattgagctgatgggc
ccccgcatggtggaaatgagttttcagaaagcgctcctgttgtctccagaggtgacagac
aggaagctgactatggaggaagaggaagccaagaggatagcagaaatgggaaagccagta
ttgggtcaacaccccaaactagaggtcatcattgaagagtcctatgagttcaagagtaca
gtggacaaattgatcaagaagacaaacttggccttggttgtggggactcattcctggagg
gaccaattcatggaagccatcactgtcagtgcagcaggggacgaggatgaggatgagtca
ggcgaggagcggctgccatcctgctttgactacgtcatgcacttcctgacggtcttctgg
aaagtgctgtttgcctgcgtgccccctacagagtactgccacggctgggcctgcttcatc
gtctccattctcatcatcggcatgctcacggccatcatcggggacctagcctctcacttc
ggctgcacgattggcctcaaggactcagtcacagctgtcgtttttgtggcatttggcact
tctgtgccagatacctttgccagcaaagctgccgccatccaggacgtgtacgcagacgcc
tccattggcaacgtcacaggcagcaacgccgtcaacgtcttcctgggcatcggcctggcc
tggtccgtggccgccatctactgggcctttcagggacaagagttccacgtgtctgcaggc
acactggccttctccgttaccctgttcaccatcttcgcgttcgtctgcatcagtgtgctc
ttgtaccgccggcggccccacctgggtggggagctcggcggccctcgtggctgcaagctt
gccacgacttggctctttgtgagcctgtggctcctctacatactctttgctagtctggag
gcctactgctacatcaaggggttctga

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107509443
Entry
107509443         CDS       T06036                                 

Gene name
SLC8A1
Definition
(RefSeq) sodium/calcium exchanger 1 isoform X1
  KO
K05849  solute carrier family 8 (sodium/calcium exchanger)
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04020  Calcium signaling pathway
ray04022  cGMP-PKG signaling pathway
ray04260  Cardiac muscle contraction
ray04261  Adrenergic signaling in cardiomyocytes
ray04371  Apelin signaling pathway
ray04740  Olfactory transduction
ray04961  Endocrine and other factor-regulated calcium reabsorption
ray04974  Protein digestion and absorption
ray04978  Mineral absorption
ray05410  Hypertrophic cardiomyopathy
ray05412  Arrhythmogenic right ventricular cardiomyopathy
ray05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    107509443 (SLC8A1)
   04020 Calcium signaling pathway
    107509443 (SLC8A1)
   04022 cGMP-PKG signaling pathway
    107509443 (SLC8A1)
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    107509443 (SLC8A1)
   04261 Adrenergic signaling in cardiomyocytes
    107509443 (SLC8A1)
  09154 Digestive system
   04974 Protein digestion and absorption
    107509443 (SLC8A1)
   04978 Mineral absorption
    107509443 (SLC8A1)
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    107509443 (SLC8A1)
  09157 Sensory system
   04740 Olfactory transduction
    107509443 (SLC8A1)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    107509443 (SLC8A1)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    107509443 (SLC8A1)
   05414 Dilated cardiomyopathy
    107509443 (SLC8A1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ray02000]
    107509443 (SLC8A1)
   00536 Glycosaminoglycan binding proteins [BR:ray00536]
    107509443 (SLC8A1)
Transporters [BR:ray02000]
 Solute carrier family (SLC)
  SLC8: Na+/Ca2+ exchanger
   107509443 (SLC8A1)
Glycosaminoglycan binding proteins [BR:ray00536]
 Heparan sulfate / Heparin
  Others
   107509443 (SLC8A1)
SSDB
Motif
Pfam: Calx-beta Na_Ca_ex Na_Ca_ex_C DnaG_DnaB_bind
Other DBs
NCBI-GeneID: 107509443
NCBI-ProteinID: XP_015997409
LinkDB
Position
Unknown
AA seq 970 aa
MLQVNLSPTFSLGFHLLAIMALLFSHVDHISAETEMEGEGNATGECTGSYYCKRGVILPI
WEPQDPSFGDKIARATVYFVAMVYMFLGVSIIADRFMSSIEVITSQEKEITIKKPNGETT
KTTVRIWNETVSNLTLMALGSSAPEILLSVIEVCGHNFTAGDLGPSTIVGSAAFNMFIII
ALCVYVVPDGETRKIKHLRVFFVTAAWSIFAYTWLYIILSVISPGVVEVWEGLLTFFFFP
ICVVFAWVADRRLLFYKYVYKRYRAGKQRGMIIEHEGDRPSSKTEIEMDGKVVNSHVDNF
LDGALVLEVDERDQDDEEARREMARILKELKQKHPEKEIEQLIELANYQVLSQQQKSRAF
YRIQATRLMTGAGNILKRHAADQARKAVSMHEVNTEMTENDPVSKIFFEQGTYQCLENCG
TVALTIIRRGGDLTNTVFVDFRTEDGTANAGSDYEFTEGTVVFKPGETQKEIRVGIIDDD
IFEEDENFLVHLSNVKVSSEASEDGILEANHISSLACLGSPSTATVTIFDDDHAGIFTFE
EPVTHVSESIGIMEVKVLRTSGARGNVIVPYKTIEGTARGGGEDFEDTCGELEFQNDEIV
KTISVKVIDDEEYEKNKTFFLEIGEPRLVEMSEKKALLLNELGGFTITGKYLYGQPVFRK
VHAREHPIPSTVITIAEECDDKQPLTSKEEEERRIAEMGRPILGEHTKLEVIIEESYEFK
STVDKLIKKTNLALVVGTNSWREQFIEAITVSAGEDDDDDECGEEKLPSCFDYVMHFLTV
FWKVLFAFVPPTEYWNGWACFIVSILMIGLLTAFIGDLASHFGCTIGLKDSVTAVVFVAL
GTSVPDTFASKVAATQDQYADASIGNVTGSNAVNVFLGIGVAWSIAAIYHAANGEQFKVS
PGTLAFSVTLFTIFAFINVGVLLYRRRPEIGGELGGPRTAKLLTSSLFVLLWLLYIFFSS
LEAYCHIKGF
NT seq 2913 nt   +upstreamnt  +downstreamnt
atgctgcaagtaaatctctcacccaccttttcactcggatttcacctgttagccatcatg
gctctcttattttcccacgtggaccatatcagcgctgagacagaaatggaaggagaaggc
aatgcaactggcgagtgtaccggctcatattactgcaagagaggggtgattttacccatt
tgggagccccaggacccttcctttggggacaaaattgctagagctactgtgtattttgtg
gccatggtctacatgtttctcggagtttctatcattgctgaccggttcatgtcctctata
gaagtcatcacatcccaagaaaaagaaataaccataaagaaacccaatggagagaccacg
aagacaaccgtgaggatctggaatgagacagtttccaacttgactttgatggccctggga
tcctctgctccagagatcctcctttcagtaattgaagtatgtggccataacttcactgct
ggagacctcggtccaagcaccatcgtgggaagtgccgcattcaatatgttcatcatcatt
gcgctttgtgtctacgtggtccccgatggagagacaaggaagataaagcatttgcgtgtg
ttcttcgtgacggcagcctggagcatcttcgcctatacctggctttacattattttgtct
gtcatctctcctggggtcgtggaggtctgggaaggtttgcttactttcttcttctttccc
atctgtgttgtgtttgcttgggtagcagaccggaggcttctgttttacaagtatgtttat
aagaggtatcgggcaggcaagcagagggggatgatcatcgaacatgaaggagacaggcca
tcttccaagactgaaattgaaatggatgggaaagttgttaattcccatgttgacaatttc
ttagatggagctctggttctggaggtcgatgagagggaccaggatgatgaagaagctagg
cgagaaatggctaggattctaaaggaactcaagcagaagcatccagagaaagaaatagaa
caattaatagaattagctaactaccaagtcctaagtcagcagcaaaaaagtcgagcattt
taccgcattcaagctactcgcctgatgactggagctggcaacattttaaagaggcatgcg
gctgaccaagccaggaaggctgtcagcatgcatgaggtgaacactgaaatgactgaaaat
gaccctgttagtaagatcttctttgaacaaggaacataccagtgtctggagaactgtggt
actgtagccctaactattatccgcagaggcggtgatttgaccaacactgtgtttgttgac
ttccgaaccgaggatggcacagccaatgctggatctgattatgaatttactgaaggaact
gtggtatttaagcctggtgagacccagaaagaaatcagagttggcatcattgatgatgat
atctttgaggaggatgaaaatttccttgtgcatctcagcaatgtcaaagtgtcttctgag
gcgtcagaagacggcatactggaagccaatcacatttcttcactcgcttgcctcggatct
ccctccactgccaccgtgactatttttgatgatgaccacgcaggcatctttactttcgag
gaacctgtgactcatgtgagtgagagcattggcatcatggaggtgaaagtattgagaaca
tctggagctcgaggaaatgttatcgttccctataaaaccattgaagggaccgccagaggt
ggaggagaggactttgaggacacttgtggagagctcgagttccagaacgatgaaattgtc
aaaacaatatcagtcaaggtaattgatgatgaggagtatgagaaaaacaagaccttcttc
cttgagattggagagccccgcctggtggagatgagtgagaagaaagccctgttattgaat
gagcttggtggcttcacaataacagggaaatacctgtatggccaacctgtcttcaggaaa
gttcacgctagagaacatccgattccctctactgtaatcaccattgcagaggaatgtgat
gacaagcagccgctgaccagcaaagaggaggaggagaggcgcattgcagaaatggggcgc
cctattttgggagaacacaccaagctggaagtgatcattgaagaatcgtatgaattcaag
agtaccgtggacaaacttattaagaagacaaacctagcccttgtggttgggacgaacagc
tggagagagcagtttattgaagccatcactgtcagcgctggggaagatgatgacgacgat
gaatgtggggaggagaagctaccctcctgtttcgattacgtgatgcactttctgactgtc
ttctggaaggtcctctttgccttcgtgccccctacagaatactggaatggctgggcatgc
ttcattgtctccatcctcatgattggcttactgacagctttcattggagacctggcttcc
cacttcggctgcaccattggcctaaaagattctgtgactgcagtagtgttcgtcgcactt
ggaacttcagtaccagacacatttgcaagcaaagtggcagccacccaggaccagtatgca
gacgcgtccatcggtaacgtcactggcagcaacgcagtgaacgtcttcctggggatcggt
gtggcctggtccattgctgccatctaccatgcggccaacggggaacagttcaaagtgtcc
cctggcacgctagctttctctgtcactctcttcaccatttttgctttcatcaatgtgggg
gtgctgctgtatcggcggaggccggaaatcggaggtgagctgggtgggccccggactgcc
aagctcctcacatcctccctctttgtgctcctatggctcctgtacattttcttctcctcc
ctggaggcctactgccacataaaaggcttctaa

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107511240
Entry
107511240         CDS       T06036                                 

Gene name
SLC24A4
Definition
(RefSeq) sodium/potassium/calcium exchanger 4 isoform X1
  KO
K13752  solute carrier family 24 (sodium/potassium/calcium exchanger), member 4
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:ray00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    107511240 (SLC24A4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ray02000]
    107511240 (SLC24A4)
Transporters [BR:ray02000]
 Solute carrier family (SLC)
  SLC24: Na+/(Ca2+-K+) exchanger
   107511240 (SLC24A4)
SSDB
Motif
Pfam: Na_Ca_ex
Other DBs
NCBI-GeneID: 107511240
NCBI-ProteinID: XP_016000944
LinkDB
Position
Unknown
AA seq 622 aa
MALPAPLRPRKVLRRREMLPQQVGFVCAVLALVCCASGLFGSLGHETTTASKHVLSDIWR
NRKLMAPVNGTQTAKNCTDPAIHEFPTDLFSNKERQHGAVLLHILGALYMFYALAIVCDD
FFVPSLEKICEKLHLSEDVAGATFMAAGSSTPELFASVIGVFITHGDVGVGTIVGSAVFN
ILCIIGVCGLFAGQVVRLTWWAVCRDSVYYTLSVIVLIAFIYDEEIVWWEGLVLIILYVF
YILIMKYNVKMQAFFTIKQKTIANGNTVNSELEDGNDYCDSSSDDPSMPLLGPVKEERQY
SKTPVVMVDEVMSSSPPKFTFPEAGLRIMITNKFGPRTRLRMASRIIINERQRLINSANG
VSSKPLQNGRHEHIENGNVPAENPEDPQRAQEQPPLPPPPAPEPEPVEAAFLSPFSVPEA
RGDKVKWVFTWPLIFLLCITIPNCSKPRWEKFFMVTFITATLWIAVFSYLMVWLVTIIGY
TFGIPDVIMGITFLAAGTSVPDCMASLIVARQGLGDMAVSNTIGSNVFDILVGLGIPWGL
QTMVINHGSTVKINSRGLVYSVVLLLGSVALTVLGIHLNKWRLDRKLGIYVLVLYAIFLC
FSIMIEFNVFTFVNLPMCREDD
NT seq 1869 nt   +upstreamnt  +downstreamnt
atggcgctcccagcgcccctccggccgcgcaaagttctcaggaggcgagagatgctgccg
cagcaagttggcttcgtgtgcgcggtgctggccctggtgtgctgtgcgtccggcctcttc
ggtagcttggggcacgaaacaacaactgcaagcaaacatgttctctcagacatatggaga
aatagaaagctgatggcacccgtgaatgggactcagaccgctaagaattgcacagatcct
gcaattcacgagttccccacggacctgttctccaataaggagcgacagcacggagccgtc
ctgctgcatatcctcggtgctctgtacatgttctacgccctggccatagtctgcgatgac
ttctttgttccatccctggagaagatctgcgagaaactccatctgagcgaagatgtggca
ggagccaccttcatggctgccggaagctcgacccccgagctgtttgcctctgtgatcggc
gtgttcatcacccacggagacgtcggggttggcaccatcgtgggctctgccgtgttcaac
atcctgtgtataatcggagtttgtgggttatttgcggggcaggtggtccgtctgacgtgg
tgggccgtgtgccgagactctgtgtactacaccctgtccgtcatcgtgctcattgccttc
atttacgatgaagaaatcgtatggtgggaaggcctggtgctcatcatcttgtatgtgttt
tacattctgatcatgaagtacaatgtgaagatgcaggcctttttcacaatcaaacaaaag
accattgcaaatggcaacacagtcaacagtgagctggaggatggtaatgattactgtgat
agtagctctgatgacccttccatgccattgctggggccagtgaaggaggaacggcagtac
agcaaaaccccagtggtgatggtggacgaagtcatgagctccagcccgcccaagttcacc
ttcccggaggcaggcttacgcataatgatcaccaataagtttgggcccaggacccggctg
cggatggccagcaggatcataattaatgagcggcagagactgatcaactcggcgaatggc
gtgagcagcaagccgcttcaaaacgggagacacgaacacatcgaaaacgggaacgttccc
gcggaaaacccagaagaccctcagcgggcgcaggagcagccacctctgcccccgccgcca
gccccggagccggagccagtcgaggccgccttcctctcccccttctccgtgcccgaggcg
agaggagacaaagtcaagtgggtgttcacctggccactcattttcctcctgtgcatcacc
atccccaactgcagcaagcctcgctgggagaagttcttcatggtcaccttcatcaccgcc
acgctgtggatcgccgtcttctcctacctaatggtgtggctggtgactattatcggatac
acatttgggatccctgacgtcatcatgggcatcactttcctggcagcaggcacgagcgtt
ccagactgcatggccagcctaatcgtggcgaggcaaggccttggcgacatggcggtctct
aataccatagggagcaacgtgttcgacatcctggtgggactgggcataccgtggggcctg
cagaccatggtcattaatcacgggtccacggtgaagatcaacagccgagggctggtctat
tccgtggtgctgctgctgggctccgtggcactcaccgtgctcggcatccatctaaacaag
tggagactggaccggaagctgggcatctacgtattggttctctatgccatcttcctgtgc
ttctcaataatgatagagtttaacgtcttcacctttgtcaacttgccgatgtgtcgagaa
gatgattag

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107516018
Entry
107516018         CDS       T06036                                 

Gene name
SLC8A2
Definition
(RefSeq) sodium/calcium exchanger 2 isoform X1
  KO
K05849  solute carrier family 8 (sodium/calcium exchanger)
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04020  Calcium signaling pathway
ray04022  cGMP-PKG signaling pathway
ray04260  Cardiac muscle contraction
ray04261  Adrenergic signaling in cardiomyocytes
ray04371  Apelin signaling pathway
ray04740  Olfactory transduction
ray04961  Endocrine and other factor-regulated calcium reabsorption
ray04974  Protein digestion and absorption
ray04978  Mineral absorption
ray05410  Hypertrophic cardiomyopathy
ray05412  Arrhythmogenic right ventricular cardiomyopathy
ray05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    107516018 (SLC8A2)
   04020 Calcium signaling pathway
    107516018 (SLC8A2)
   04022 cGMP-PKG signaling pathway
    107516018 (SLC8A2)
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    107516018 (SLC8A2)
   04261 Adrenergic signaling in cardiomyocytes
    107516018 (SLC8A2)
  09154 Digestive system
   04974 Protein digestion and absorption
    107516018 (SLC8A2)
   04978 Mineral absorption
    107516018 (SLC8A2)
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    107516018 (SLC8A2)
  09157 Sensory system
   04740 Olfactory transduction
    107516018 (SLC8A2)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    107516018 (SLC8A2)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    107516018 (SLC8A2)
   05414 Dilated cardiomyopathy
    107516018 (SLC8A2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ray02000]
    107516018 (SLC8A2)
   00536 Glycosaminoglycan binding proteins [BR:ray00536]
    107516018 (SLC8A2)
Transporters [BR:ray02000]
 Solute carrier family (SLC)
  SLC8: Na+/Ca2+ exchanger
   107516018 (SLC8A2)
Glycosaminoglycan binding proteins [BR:ray00536]
 Heparan sulfate / Heparin
  Others
   107516018 (SLC8A2)
SSDB
Motif
Pfam: Calx-beta Na_Ca_ex Na_Ca_ex_C
Other DBs
NCBI-GeneID: 107516018
NCBI-ProteinID: XP_016010877
LinkDB
Position
Unknown
AA seq 966 aa
MVCKSQPCLSVELDLKSFSTTPRGLGEDPSFLEGRGPQRRTPPPSMAPLALVGVALLLGA
PPCSGAATPTPSLPPPPANDSDASTGVCQGSNRCQPGVLLPVWEPDDPSLGDKAARAVVY
FVAMVYMFLGVSIIADRFMASIEVITSKEKEITITKANGETSVGTVRIWNETVSNLTLMA
LGSSAPEILLSVIEVCGHNFQAGELGPGTIVGSAAFNMFVVIAVCIYVIPAGESRKIKHL
RVFFVTASWSIFAYVWLYLILAVFSPGVVQVWEALLTLVFFPVCVVFAWMADKRLLFYKY
VYKRYRTDPRSGIIIGAEGDPPKSIELDGTFVGAEAPGELGGLGPGPSEARELDASRREV
IQILKDLKQKHPDKDLEQLVGIANYYALLHQQKSRAFYRIQATRLMTGAGNVLRRHAADA
SRRAGPADGPAEDEDDGASHIFFEPSMYHCLENCGSVLLSVTCEGGEGNSTFYVDYRTED
GSAKAGSDYEYSEGTLVFKPGETQKELRIGIIDDDIFEEDEHFFVRLLNLRVGDAQGMFE
PDGGGRPKGRLVAPLLATVTILDDDHAGIFSFQDRLLHVSECMGTVDVRVVRSSGARGTV
RLPYRTVDGTARGGGVHYEDACGELEFGDDETMKTLQVKIVDDEEYEKKDNFFIELGQPQ
WLKRGISALLLNQGDGDRKLTAEEEEARRIAEMGKPVLGENCRLEVIIEESYDFKNTVDK
LIKKTNLALVIGTHSWREQFLEAITVSAGDEEEEEDGSREERLPSCFDYVMHFLTVFWKV
LFACVPPTEYCHGWACFGVCILVIGLLTALIGDLASHFGCTVGLKDSVNAVVFVALGTSI
PDTFASKVAALQDQCADASIGNVTGSNAVNVFLGLGVAWSVAAVYWAVQGQPFEVRTGTL
AFSVTLFTVFAFVGIAVLLYRRRPHIGGELGGPRGPKLATTALFLGLWFLYILFASLEAY
CHIRGF
NT seq 2901 nt   +upstreamnt  +downstreamnt
atggtgtgcaagtcgcagccctgtctctcggtggaactggatctcaaaagcttctccacc
accccccgggggctcggagaggatccttctttcctggagggaagggggccccagagaaga
accccgccaccctccatggctcccctggctctggtgggggttgcgctcctcctaggggct
cccccatgctcaggggcggccaccccgaccccatctctaccacctcccccggccaatgac
agcgatgccagcacgggcgtctgccagggctccaaccgctgccagccgggggtcctgctg
cccgtctgggagcccgacgacccatccttgggcgacaaggcggcgagagccgtggtctac
tttgtggccatggtctacatgttcctgggcgtgtccatcatcgccgaccgcttcatggct
tccatcgaggtcatcacgtcgaaggagaaggagatcaccatcaccaaggccaacggcgag
acaagcgtgggcaccgtccgcatctggaatgagaccgtgtccaacctcacactcatggcc
ctgggctcctcggcaccggagatcctgctgtctgtcatcgaggtctgcggccacaacttc
caggccggtgagctgggcccgggcaccatcgtgggcagcgctgccttcaacatgtttgtg
gtcattgccgtgtgcatctacgtcatcccggctggcgagagccgcaagatcaagcacctg
agggtcttctttgtcaccgcctcgtggagtatcttcgcctacgtctggctttatctcatc
cttgccgtcttttcccccggtgtggtccaggtgtgggaggcgctgctgacactcgtcttc
ttcccggtgtgcgtcgtgttcgcctggatggccgacaagcggctgctcttctacaagtat
gtgtacaagcgctaccgcaccgacccgcgcagcggcatcatcatcggcgccgagggcgac
ccccccaagagcatcgagctggacggcacgttcgtgggcgccgaggccccgggcgagctg
ggcggcctgggcccgggcccctccgaggcccgcgagctggacgccagccgccgcgaggtc
atccagatcctcaaggacctcaagcagaagcaccccgacaaggacctggagcagctggtg
ggcatcgccaactactacgcgctgctgcaccagcagaagagccgcgccttctaccgcatc
caggccacgcggctgatgaccggcgcgggcaacgtgctgcggcgacacgcggcggacgcg
tcgcgccgtgccggcccggccgacggccccgccgaggacgaggacgacggcgccagccac
atcttcttcgagcccagcatgtaccactgcctggagaactgcggctccgtgctgctgtct
gtcacgtgcgagggcggcgagggcaacagcaccttctacgtggactaccgcacggaggac
ggctcggccaaggccggctccgactacgagtacagcgagggcacgctggtgttcaagcca
ggcgagacgcagaaggagctgcgcatcggcatcatcgacgacgacattttcgaggaggac
gagcacttcttcgtgcggctgctgaacctgcgcgtgggcgacgcgcagggcatgttcgag
cccgacggcggcgggcggcccaaggggcggctggtggcgccgctgctggccaccgtcacc
atcctggacgacgaccacgcgggcatcttctccttccaggaccgcctgctgcacgtgagc
gagtgcatgggaaccgtggacgtgcgcgtcgtgcgcagctcgggcgcgcgcggcactgtg
cgtctcccctaccgcacggtggacggcacggcgcgcggcggcggcgtgcactacgaggac
gcgtgcggcgagctcgagtttggcgacgacgagaccatgaaaactctgcaagtgaagata
gtcgatgacgaggaatatgagaaaaaggataatttcttcatcgagctgggccagccgcag
tggcttaagcgagggatttcagctctgctgcttaatcaaggggatggggacaggaagttg
acggcagaggaggaggaggctcggcggatagcagagatgggcaagccagttcttggggaa
aactgccggctggaggtcatcatcgaggagtcgtatgattttaagaacacagtggacaaa
ctcatcaagaaaacaaatttggctttggtgattgggacccattcgtggagggagcagttt
ttagaggcaattacggtgagcgcaggggacgaggaggaggaggaggacgggtcccgggag
gagcggctgccttcctgctttgactacgtcatgcacttcctgacggtgttctggaaggtg
ctgttcgcctgcgtcccgcccactgagtactgccatggctgggcctgcttcggcgtctgc
atcctggtcatcggcctgctcacagccctcatcggcgacctcgcctcccacttcggctgc
accgttggcctcaaggactccgtcaatgctgtggtcttcgtggccctgggcacctccatc
cccgacacattcgccagcaaggtggcggcgctgcaggaccagtgcgcggacgcgtccatc
ggcaacgtgaccggctccaacgccgtgaacgtgttcttgggcctgggcgtggcctggtca
gtggccgccgtgtactgggcggtgcagggccagccgttcgaggtgcgcaccggcacgctg
gccttctccgtgacgctcttcaccgtcttcgccttcgtgggcatcgccgtgctgctgtac
cggcgccggccgcacatcggcggggagctgggcggcccgcgcggccccaagctcgccacc
acggcgctcttcctgggcctctggttcctctacatcctcttcgccagcctcgaggcctac
tgccacatccggggcttctag

DBGET integrated database retrieval system