KEGG   Rousettus aegyptiacus (Egyptian rousette): 107503391
Entry
107503391         CDS       T06036                                 

Gene name
CCND1
Definition
(RefSeq) G1/S-specific cyclin-D1
  KO
K04503  G1/S-specific cyclin-D1
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray01522  Endocrine resistance
ray04068  FoxO signaling pathway
ray04110  Cell cycle
ray04115  p53 signaling pathway
ray04151  PI3K-Akt signaling pathway
ray04152  AMPK signaling pathway
ray04218  Cellular senescence
ray04310  Wnt signaling pathway
ray04340  Hedgehog signaling pathway
ray04371  Apelin signaling pathway
ray04390  Hippo signaling pathway
ray04510  Focal adhesion
ray04530  Tight junction
ray04630  JAK-STAT signaling pathway
ray04917  Prolactin signaling pathway
ray04919  Thyroid hormone signaling pathway
ray04921  Oxytocin signaling pathway
ray04933  AGE-RAGE signaling pathway in diabetic complications
ray04934  Cushing syndrome
ray05160  Hepatitis C
ray05162  Measles
ray05163  Human cytomegalovirus infection
ray05165  Human papillomavirus infection
ray05166  Human T-cell leukemia virus 1 infection
ray05167  Kaposi sarcoma-associated herpesvirus infection
ray05169  Epstein-Barr virus infection
ray05200  Pathways in cancer
ray05203  Viral carcinogenesis
ray05205  Proteoglycans in cancer
ray05206  MicroRNAs in cancer
ray05210  Colorectal cancer
ray05212  Pancreatic cancer
ray05213  Endometrial cancer
ray05214  Glioma
ray05215  Prostate cancer
ray05216  Thyroid cancer
ray05218  Melanoma
ray05219  Bladder cancer
ray05220  Chronic myeloid leukemia
ray05221  Acute myeloid leukemia
ray05222  Small cell lung cancer
ray05223  Non-small cell lung cancer
ray05224  Breast cancer
ray05225  Hepatocellular carcinoma
ray05226  Gastric cancer
ray05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    107503391 (CCND1)
   04340 Hedgehog signaling pathway
    107503391 (CCND1)
   04390 Hippo signaling pathway
    107503391 (CCND1)
   04371 Apelin signaling pathway
    107503391 (CCND1)
   04630 JAK-STAT signaling pathway
    107503391 (CCND1)
   04068 FoxO signaling pathway
    107503391 (CCND1)
   04151 PI3K-Akt signaling pathway
    107503391 (CCND1)
   04152 AMPK signaling pathway
    107503391 (CCND1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    107503391 (CCND1)
   04115 p53 signaling pathway
    107503391 (CCND1)
   04218 Cellular senescence
    107503391 (CCND1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107503391 (CCND1)
   04530 Tight junction
    107503391 (CCND1)
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    107503391 (CCND1)
   04921 Oxytocin signaling pathway
    107503391 (CCND1)
   04919 Thyroid hormone signaling pathway
    107503391 (CCND1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107503391 (CCND1)
   05206 MicroRNAs in cancer
    107503391 (CCND1)
   05205 Proteoglycans in cancer
    107503391 (CCND1)
   05203 Viral carcinogenesis
    107503391 (CCND1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    107503391 (CCND1)
   05212 Pancreatic cancer
    107503391 (CCND1)
   05225 Hepatocellular carcinoma
    107503391 (CCND1)
   05226 Gastric cancer
    107503391 (CCND1)
   05214 Glioma
    107503391 (CCND1)
   05216 Thyroid cancer
    107503391 (CCND1)
   05221 Acute myeloid leukemia
    107503391 (CCND1)
   05220 Chronic myeloid leukemia
    107503391 (CCND1)
   05218 Melanoma
    107503391 (CCND1)
   05219 Bladder cancer
    107503391 (CCND1)
   05215 Prostate cancer
    107503391 (CCND1)
   05213 Endometrial cancer
    107503391 (CCND1)
   05224 Breast cancer
    107503391 (CCND1)
   05222 Small cell lung cancer
    107503391 (CCND1)
   05223 Non-small cell lung cancer
    107503391 (CCND1)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    107503391 (CCND1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    107503391 (CCND1)
   04934 Cushing syndrome
    107503391 (CCND1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    107503391 (CCND1)
   05162 Measles
    107503391 (CCND1)
   05160 Hepatitis C
    107503391 (CCND1)
   05163 Human cytomegalovirus infection
    107503391 (CCND1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    107503391 (CCND1)
   05169 Epstein-Barr virus infection
    107503391 (CCND1)
   05165 Human papillomavirus infection
    107503391 (CCND1)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    107503391 (CCND1)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 107503391
NCBI-ProteinID: XP_015987090
LinkDB
Position
Unknown
AA seq 296 aa
MAHQLLCCEVETIRRAYPDANLLNDRVLRAMLKAEETCAPSVSYFKCVQKEILPSMRKIV
ATWMLEVCEEQKCEEEVFPLAMNYLDRFLSLEPVKKSRLQLLGATCMFVASKMKETIPLT
AEKLCIYTDNSIRPEELLQMELLLVNKLKWNLAAMTPHDFIEHFLSKMPVAEENKQIIRK
HAQTFVALCATDVKFISNPPSMVAAGSVVAAVQGLHLGSSGSFLSYHRLTRFLSKVIKCD
PDCLRACQEQIEALLESSLRQAQQQSLDPKAAEEEEEEEEEADLACTPTDVRDVNI
NT seq 891 nt   +upstreamnt  +downstreamnt
atggcacaccagctcctgtgctgcgaggtggagaccatccgccgggcgtaccccgatgcc
aacctcctcaacgaccgggtgctccgggccatgctcaaggcggaggagacctgcgcgccc
tcggtgtcctacttcaagtgcgtgcagaaggagatcctgccgtccatgcggaagatcgtg
gccacctggatgctggaggtctgcgaggagcagaagtgcgaggaggaggtcttcccgctg
gccatgaactacctggaccgcttcctgtctctggagcccgtgaagaagagccgcctgcag
ctgctcggggccacctgcatgttcgtcgcctcgaagatgaaggagaccatccccctgacg
gccgagaagttgtgcatctacactgacaactccatccggcccgaggagctgctgcaaatg
gaactgctgctggtgaacaaactcaagtggaacctggccgccatgaccccgcacgatttc
atcgagcacttcctctctaaaatgccggtggccgaggagaacaagcagatcatccgcaag
catgcgcagaccttcgttgccctctgtgccacagacgtgaagttcatctccaacccgccc
tccatggtggccgcggggagcgtggtggccgcggtgcaaggcctgcacctggggagttcc
ggaagcttcctgtcttatcaccgcctcacgcgcttcctctccaaagtgattaagtgtgac
ccggactgcctccgggcctgccaggagcagatcgaagccctgctggagtccagcctgcgc
caggcccagcagcagagcctggaccccaaggccgccgaggaggaggaggaggaggaggag
gaggccgacctggcctgcacccccaccgacgtgcgggacgtgaacatctga

DBGET integrated database retrieval system