KEGG   Rousettus aegyptiacus (Egyptian rousette): 107503467
Entry
107503467         CDS       T06036                                 

Gene name
LRP5
Definition
(RefSeq) LOW QUALITY PROTEIN: low-density lipoprotein receptor-related protein 5
  KO
K03068  low density lipoprotein receptor-related protein 5/6
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04150  mTOR signaling pathway
ray04310  Wnt signaling pathway
ray04928  Parathyroid hormone synthesis, secretion and action
ray05010  Alzheimer disease
ray05022  Pathways of neurodegeneration - multiple diseases
ray05200  Pathways in cancer
ray05224  Breast cancer
ray05225  Hepatocellular carcinoma
ray05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    107503467 (LRP5)
   04150 mTOR signaling pathway
    107503467 (LRP5)
 09150 Organismal Systems
  09152 Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    107503467 (LRP5)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107503467 (LRP5)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    107503467 (LRP5)
   05226 Gastric cancer
    107503467 (LRP5)
   05224 Breast cancer
    107503467 (LRP5)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    107503467 (LRP5)
   05022 Pathways of neurodegeneration - multiple diseases
    107503467 (LRP5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ray04131]
    107503467 (LRP5)
Membrane trafficking [BR:ray04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Low-density lipoprotein receptor (LDLR) family proteins
    107503467 (LRP5)
SSDB
Motif
Pfam: Ldl_recept_b FXa_inhibition Ldl_recept_a DUF5050 SGL Insulin_TMD DUF5653
Other DBs
NCBI-GeneID: 107503467
NCBI-ProteinID: XP_015987284
LinkDB
Position
Unknown
AA seq 1676 aa
MPVVMSVRALRGITSVVFSCVCAARPVLMSLTSGRLSARGGKSARFRGGPGLKWADEAEP
LCTATGTVLDRVARPRFLRSTFASVRSAASSPLLLFANRRDVRLVDAGGVKLESTVVVSG
LEDAAAVDFQFSKGAVYWTDVSEEAIKQTYLNRTGAAVQSVVISGLVSPDGLACDWVGKK
LYWTDSETNRIEVANLNGTSRKVLFWQDLDQPRAVALDPAHGYMYWTDWGETPRIERAGM
DGSTRKVIVDSDIYWPNGLTIDLEEQKLYWADAKLSFIHRANLDGSFRQKVVEGSLTHPF
ALTLSGDTLYWTDWQTRSIHACNKRTGEKRREILGALYSPMDIQVLSPERQPYFHTRCEE
DNGGCSHLCLLSPREPFYTCACPTGVQLQDNGKTCKAGAEEVLLLARRTDLRRISLDTPD
FTDIVMQVDDIRHAIAIDYDPLEGHVYWTDDEVRAIRRAYLDGSGAQTLVDTEVNDPDGI
AVDWVARNLYWTDTGTDRIEVARLNGTSRKILVSEDLDEPRAIVLHPGMGLMYWTDWGEN
PKIECADLDGQERHVLVNTSLGWPNGLALDLQEGKVYWGDAKTDKIEVINVDGTKRRTLL
EDKLPHIFGFTLLGDFIYWTDWQRRSIERVHKVKASRDVIIDQLPDLMGLKAVNVAKVVG
TNPCADRNGGCSHLCFFTPHATKCGCPIGLELLSDMKTCIVPEAFLVFTSRAAIHRISLE
TSSSDVAIPLTGVKEASALDFDVSSGHIYWTDIILKTISRAFMNGSSVEHVIEFGLDYPE
GMAVDWMGKNLYWADTGTNRIEVARLDGQFRQVLVWRDLDNPRSLALDPTKGYIYWTEWG
GKPRIVQAFMDGTNCMTLVDKVGRANDLTIDYADQRLYWTDLDTNMIESSNMLGQGRVVI
ADDLPYPFGLTQYGDYIYWTDWNLHSIERADKTSGRNRTLVQGHLDFVMDLLVFHASRQD
GLNDCVHSNGQCGQLCLAVPGGRRCGCASHYTLDPGGRNCSPPSTFLLFSQKNAISRMIP
DDQHSPDLMLPLHGLRNVKAIDYDPLDKFIYWVDGRQNIRRAKDDGTQPSVLTSPSPHQS
PDRQPHDLSIDVYSRTLFWTCEATNTINVHRLNGDAMGVVLRGGRDKPRALVVNAERGYL
YFTNMQEPAAKIERTALDGTEREVLFTTGLIRPVALVVDNARWAQDLFWSDCDLKXIESC
DLSGANRLTLEDANVVQPVGLAVLGRHLYWIDRQQQMIERVEKTSGDKRTRVQGRVAHLT
GIHAVEDVSLEEFSAHPCARDNGGCSHICIAKGDGTPRCSCPVHLVLLQNLLTCGEPPTC
SPDQFACATGEIDCIPGAWRCDGFPECDDQSDEEGCPVCSAAQFPCARGQCVDLRLRCDG
EADCQDRSDEADCDAVCLPSQFRCASGQCVLIKQQCDSFPDCVDGSDELMCEISKPPSDD
TPAHSSAIGPVIGIILSLFVMGGVYFVCQRVLCQRYTGASGPFPHEYVSGTPHVPLNFIA
PGASQHGPFTGISCGKSMMSSVSLMGGRGGVPLYDRNHVTGASSSSSSSTKATLYPPILN
PPPSPATDPSLYNVDTFYSSSVPAPARPYRPYIIRGMAPPTTPCSTDVCDSDYSASRWKA
SKYYLDLNSDSDPYPPPPTPHSQYLSAEDSCPPSPATERSYFHLFPPPPSPCTDSS
NT seq 5031 nt   +upstreamnt  +downstreamnt
atgcctgtcgtcatgtcggttcgagctctaagaggaatcacatctgtggtgttcagctgc
gtgtgtgcagcacgaccagtgctgatgagtttaacgtcaggacgcctgtcagcacgcggc
ggcaagagcgcccgcttccgcggcggcccgggcctaaaatgggcggacgaggcggaacct
ctttgcacagccactgggactgtcctcgatagggtggcccgcccccgatttctgcgttcg
acttttgcctccgtccggagtgcagcctcctcgccgctcctgctgtttgccaaccgccgg
gatgtgcggctggtggatgccggcggcgtcaagctggagtccacggtcgtggtcagcggc
ctggaggacgcggccgcggtggacttccagttctccaagggagccgtgtactggacggac
gtgagcgaggaggccatcaagcagacctacctgaaccggacgggggcggccgtgcagagc
gtggtcatctccggcctggtgtctcccgacggcctcgcctgtgactgggtcggcaagaag
ctgtactggaccgactcggagaccaatcgcatcgaggtggccaacctcaacgggacgtcc
cggaaggtcctgttctggcaggacctggaccagccgcgggccgtcgccctggaccccgct
cacgggtacatgtactggacagactggggcgagacgccccgaatcgagcgggcggggatg
gatggcagcacccgcaaagtcatcgtggactcggacatttactggcccaatgggctgacc
atcgacctggaggagcagaagctttactgggccgacgccaagctcagcttcatccaccgt
gccaatctggacggctcgtttcggcagaaggtggtggagggcagcctgacgcaccccttt
gccctgacgctctctggggacactctgtactggaccgactggcagacccgctccattcac
gcctgtaacaagaggacgggggagaagcggagggagattctcggtgctctctactcgccc
atggacattcaagtgctcagccctgagaggcagccgtacttccacacgcggtgcgaggag
gacaacggcggctgctcccacctgtgtctgctgtctccgcgggagccgttctacacgtgc
gcctgccccacaggtgtgcagcttcaggacaacggcaagacgtgcaaggcaggggccgag
gaggtgctgctgctggcccggcggacggacctgcggaggatctcgctggacacgccggac
ttcacggacatcgtgatgcaggtggacgacatccgccacgccatcgccatcgactacgac
ccgctggagggccacgtctactggacggacgacgaggtgcgggccatccgcagggcgtac
ctggacgggtcgggcgcgcagacgctggtcgacaccgaggtcaacgaccctgacggcatc
gccgtcgactgggtggcccgcaacctctactggacggacacgggcaccgaccgcatcgag
gtggcacgcctcaacggcacctcccgcaagatcctggtgtccgaggacctggacgagccc
cgcgccattgtgctgcaccccggcatgggcctcatgtactggacggactggggggaaaac
cccaaaatcgagtgcgccgacctggatgggcaggagcggcacgtgctggtgaacacctcc
ctcggctggcccaacggcttggccctggacctgcaggagggcaaggtgtactggggagac
gccaagacggacaagatcgaggtgatcaatgtcgacgggacgaagaggcggacgctgctg
gaggacaagctcccgcacattttcgggttcacgctgctgggcgacttcatctactggacc
gactggcagcggcgcagcatcgagcgtgtgcacaaggtcaaggccagccgggacgtcatc
atcgaccagctgcccgacctgatggggctcaaggccgtgaacgtggccaaggtcgtcggg
accaacccgtgtgcggacaggaacggggggtgcagccacctgtgcttcttcacgccccac
gccaccaagtgcggctgccccatcggcctggagctcctgagcgacatgaagacctgcatc
gtgcccgaggccttcctcgtgttcaccagcagagccgccatccacaggatctcccttgag
accagcagcagcgacgtggccatccccctcacgggcgtcaaggaggcctctgcgctggac
ttcgatgtgtccagcggtcacatctactggacggacatcatcctcaagaccatcagccgc
gccttcatgaatgggagctcggtggagcacgtgatcgagtttggcctcgactacccggaa
ggcatggctgttgactggatgggcaagaacctctactgggcagacactgggaccaacagg
atcgaagtggcccggctggacgggcagttccggcaggtcctcgtgtggagggacttggac
aacccgaggtcgctggccctggaccccaccaaaggctacatctactggaccgagtggggc
ggcaagccgaggatcgtgcaggctttcatggacgggaccaactgcatgacgctggtggac
aaggtgggccgggccaatgacctcaccatcgactacgccgaccagcgtctctactggact
gacttggacaccaacatgatcgagtcatccaacatgttgggtcaggggcgggtcgtgatc
gccgacgacctcccgtaccccttcggcctgactcagtacggcgactacatctactggacg
gactggaacctgcacagcatcgagcgggcggacaagaccagcggccggaaccgcaccctc
gtgcagggccacctggacttcgtgatggacctgctggtgttccacgcctcccgccaggac
ggcctcaacgactgcgtgcacagcaacgggcagtgcgggcagctgtgcctcgccgtcccc
ggcggccgccgctgcggctgcgcctcgcactacacgctggaccccggcggccgcaactgc
agcccgcccagcaccttcttgctgttcagccagaaaaacgccatcagccggatgatcccg
gacgaccagcacagcccggacctcatgctgcccttgcacgggctgcggaacgtcaaagcc
atcgactacgacccgctggacaagttcatctactgggtggacgggcggcagaacatcagg
cgggccaaggacgacgggacccagccgtccgttctgacctctcccagcccgcaccagagc
ccggacaggcagccacacgatctcagcatcgacgtgtacagccggacgctgttctggacg
tgcgaggccaccaacaccatcaacgtgcaccggctgaacggggacgccatgggcgtggtg
ctccgcgggggccgcgacaagccccgggctctcgtcgtcaacgccgagcgagggtacctg
tacttcaccaacatgcaggagccggcggccaagatcgagcgcacggccctggacggcacg
gaacgtgaggtcctctttaccaccggcctcatccgccctgtggccctcgtggtggacaac
gcgcgctgggctcaagacctcttctggtcggactgcgacctgaagnccatcgaaagctgc
gacctgtcaggggccaaccgcctgacgctggaggacgccaacgtggtgcagcccgtgggc
ctggccgtgctgggcaggcacctgtactggatcgaccgccagcagcagatgatcgagcgc
gtggagaagaccagcggagacaagcgaacgcgcgtccagggccgcgtcgcccacctgacc
ggcatccacgccgtggaggacgtcagcctggaggagttctcggcccacccatgcgcccgg
gacaacgggggctgctcccacatctgcatcgccaagggcgacgggacgccgcgctgctcg
tgcccagtgcacctggtgcttctgcagaacctgctgacctgtggcgagcctcccacctgc
tcccccgaccagttcgcctgtgccacgggggagatcgactgcatccccggggcctggcgc
tgcgacggtttccctgagtgtgacgaccagagcgacgaggagggttgtcccgtgtgctcg
gccgcccagttcccctgcgcgcggggccagtgcgtggacctgcgactgcgctgcgacggc
gaggccgactgccaggaccgctcagacgaagcggactgcgacgccgtctgcctgcccagc
cagttccggtgcgccagcggccaatgcgtgctcatcaagcagcagtgcgactccttcccc
gactgcgtggacggctccgacgagctgatgtgcgaaatctccaagccgccctccgacgac
accccagcccacagcagtgccatcgggcccgtcatcggcatcatcctctcgctcttcgtc
atggggggcgtctacttcgtgtgccagcgcgtgctgtgtcagcgctacacgggggccagc
gggcccttcccacacgagtatgtcagcgggaccccccacgtgcccctcaacttcatagcc
ccaggcgcctcacagcatggtcccttcacaggcatctcatgtggcaagtccatgatgagc
tctgtgagcctgatgggtggccggggcggggtgcctctctacgaccggaaccacgtcacc
ggggcctcgtccagcagctcatccagcaccaaggccacactgtacccgccgatcctgaac
cccccgccgtctcccgccacagacccctctctgtacaacgtggacacattctactcttca
agcgttcccgcgcccgccaggccgtacaggccctacatcatccgcggcatggcgcccccg
accacgccttgcagcacagacgtgtgtgacagtgactacagtgccagccgctggaaggcc
agcaagtactacctggacttgaactcagactcggacccctacccgcccccgcccacaccc
catagccagtacctgtctgcggaggacagctgccccccgtcgcccgccaccgagaggagc
tacttccatctcttcccgcccccgccgtccccctgcacggactcgtcctga

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107516546
Entry
107516546         CDS       T06036                                 

Gene name
LRP6
Definition
(RefSeq) low-density lipoprotein receptor-related protein 6 isoform X1
  KO
K03068  low density lipoprotein receptor-related protein 5/6
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04150  mTOR signaling pathway
ray04310  Wnt signaling pathway
ray04928  Parathyroid hormone synthesis, secretion and action
ray05010  Alzheimer disease
ray05022  Pathways of neurodegeneration - multiple diseases
ray05200  Pathways in cancer
ray05224  Breast cancer
ray05225  Hepatocellular carcinoma
ray05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    107516546 (LRP6)
   04150 mTOR signaling pathway
    107516546 (LRP6)
 09150 Organismal Systems
  09152 Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    107516546 (LRP6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107516546 (LRP6)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    107516546 (LRP6)
   05226 Gastric cancer
    107516546 (LRP6)
   05224 Breast cancer
    107516546 (LRP6)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    107516546 (LRP6)
   05022 Pathways of neurodegeneration - multiple diseases
    107516546 (LRP6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ray04131]
    107516546 (LRP6)
Membrane trafficking [BR:ray04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Low-density lipoprotein receptor (LDLR) family proteins
    107516546 (LRP6)
SSDB
Motif
Pfam: Ldl_recept_b FXa_inhibition Ldl_recept_a DUF5050 SGL cEGF
Other DBs
NCBI-GeneID: 107516546
NCBI-ProteinID: XP_016011852
LinkDB
Position
Unknown
AA seq 1613 aa
MGAVLRSLLACSFCVLLRAAPLLLYANRRDLRLVDATNGKENATIVVGGLEDAAAVDFVF
GHGLIYWSDVSEEAIKRTEFNKTESVQNVVVSGLLSPDGLACDWLGEKLYWTDSETNRIE
VSNLDGSLRKVLFWQELDQPRAIALDPSSGFMYWTDWGEVPKIERAGMDGSSRFIIINTE
IYWPNGLTLDYQEQKLYWADAKLNFIHKSNLDGTNRQAVVKGSLPHPFALTLFEDTLYWT
DWNTHSILACNKHTGEGLREIHSNIFSPMDIHAFSQQRQPNATNPCGIDNGGCSHLCLMS
PVKPFYQCACPTGVKLLENGKTCKDGATELLLLARRTDLRRISLDTPDFTDIVLQLEDIR
HAIAIDYDPVEGYIYWTDDEVRAIRRSFIDGSGSQFVVTAQIAHPDGIAVDWVARNLYWT
DTGTDRIEVTRLNGTMRKILISEDLEEPRAIVLDPMVGYMYWTDWGEIPKIERAALDGSD
RVVLVNTSLGWPNGLALDYDEGKIYWGDAKTDKIEVMNTDGTGRRVLVEDKIPHIFGFTL
LGDYVYWTDWQRRSIERVHKRSAEREIIIDQLPDLMGLKATNVHRIIGSNPCAEENGGCS
HLCLYRPQGLRCACPIGFELISDMKTCIVPEAFLLFSRRADIRRISLETNNNNVAIPLTG
VKEASALDFDVTDNRIYWTDISLKTISRAFMNGSALEHVVEFGLDYPEGMAVDWLGKNLY
WADTGTNRIEVSKLDGQHRQVLVWKDLDSPRALALDPAEGFMYWTEWGGKPKIDRAAMDG
SERTTLVPNVGRANGLTIDYAKRRLYWTDLDTNLIESSNMLGLNREVIADDLPHPFGLTQ
YQDYIYWTDWSRRSIERANKTSGQNRTIIQGHLDYVMDILVFHSSRQAGWNECASSNGHC
SHLCLAVPVGGFVCGCPAHYSLNSDNRTCSAPTTFLLFSQKSAINRMVIDEQQSPDIILP
IHSLRNVRAIDYDPLDKQLYWIDSRQNMIRKAQEDGSQGFTVVVSSVPNQNLEIQPYDLS
IDIYSRYIYWTCEATNVINVTRLDGRSIGVVLKGEQDRPRAIVVNPEKGYMYFTNLQERS
PKIERAALDGTEREVLFFSGLSKPIALALDSRLGKLFWADSDLRRIESSDLSGANRIVLE
DSNILQPVGLTVFENWLYWIDKQQQMIEKIDMTGREGRTKVQARIAQLSDIHAVKELNLQ
EYRQHPCAQDNGGCSHICLVKGDGTTRCSCPMHLVLLQDELSCGEPPTCSPQQFTCFTGE
IDCIPVAWRCDGFTECEDHSDELNCPVCSESQFQCASGQCIDGALRCNGDANCQDKSDEK
NCEVLCLIDQFRCANGQCIGKHKKCDHNVDCSDKSDEVDCYPTEEPTPQATNTVGSVIGV
IVTIFVSGTIYFICQRMLCPRMKGDGETMTNDYVVHGPASVPLGYVPHPGSLSGSLPGMS
RGKSMISSLSIMGGSSGPPYDRAHVTGASSSSSSSTKGTYFPAILNPPPSPATERSHYTM
EFGYSSNSPSTHRSYSYRPYSYRHFAPPTTPCSTDVCDSDYAPSRRMTSVATAKGYTSDL
NYDSEPVPPPPTPRSQYLSAEENYESCPPSPYTERSYSHHLYPPPPSPCTDSS
NT seq 4842 nt   +upstreamnt  +downstreamnt
atgggggccgtcctgaggagcctcctggcctgcagtttctgcgtgctcctgagagcggcc
cctttgctgctttatgcaaacagacgggacttacgattggttgatgctacaaatggcaaa
gagaatgctacgattgtagttggaggcttggaggatgcagctgcagtggactttgtgttt
ggtcatggcttgatatactggagtgatgtcagcgaagaagccattaaacgaacagagttt
aacaaaactgagagtgtacagaatgttgttgtttccggattattgtcccccgatgggttg
gcatgcgattggcttggagaaaagttatattggacagattctgaaactaatcggattgaa
gtttctaatttagatggatctttacgaaaagttttattttggcaagagttggatcaaccg
agagctattgccttagatccttcaagtgggttcatgtactggacagactggggagaagta
ccaaagatagaacgtgctggaatggatggttcaagtcgtttcattataataaacactgaa
atttactggccaaatggattgactttggattaccaggaacagaagctttattgggcggat
gcaaaacttaatttcatccataaatcaaatctggatggaacaaatcggcaggcagtggtt
aaaggttcccttccacatccttttgccttgacgttatttgaggacacattgtactggact
gattggaatacacactccattttggcttgcaacaagcacactggcgagggtctgcgtgaa
atccattctaacatcttctctcccatggatatacatgctttcagccagcagaggcagcca
aatgctacaaatccatgtggaattgataatggtggttgttcccacttgtgtttgatgtct
ccagtcaagcctttttatcagtgtgcttgcccgactggggtcaaactcctggagaatgga
aaaacctgcaaagatggtgccactgaattgttgcttttagcccgaaggacagacttgaga
cgcatttctttggatacaccagacttcacagacattgttctacagttagaagacatccgt
catgccattgcgatagattatgaccctgtggaaggctatatctactggactgatgatgaa
gtgagggccatacgccgctcattcatagatggatctggcagtcagtttgtggtcaccgct
caaattgcacaccctgatggtattgctgttgactgggttgcccgaaatctttattggaca
gacactggcactgatcggatagaagtgacaaggctcaatggcaccatgaggaagatcttg
atttcagaggacttagaggaaccccgggctattgtgttagatcccatggttgggtacatg
tattggactgactggggagaaatcccgaaaattgagcgagcagctctggatggttctgac
cgagtagtgttggttaacacttctcttggttggccaaatggtttagccttggattatgat
gaaggcaaaatatactggggagatgccaaaacagacaaaattgaggttatgaataccgat
ggcactgggagacgagtcctagtggaagacaaaattcctcacatatttgggtttactttg
ttgggtgactatgtttactggactgactggcagaggcgtagcatcgaaagagtacacaaa
cgaagtgcagagagggaaatcatcatagatcagctccctgacctcatgggcttaaaggcc
acaaatgttcatagaatcatcggttccaacccctgtgctgaggaaaatgggggatgtagc
catctttgcctctatagacctcagggacttcgctgtgcctgtcccattggctttgaactc
atcagtgacatgaagacctgcattgtcccagaggcttttcttttgttttcacggagagca
gatatcaggagaatttctttggaaactaacaataataatgtagccattccgctcactggt
gtcaaagaagcttctgctttggattttgatgtgacagacaaccgaatttactggactgat
atatcactcaagaccatcagcagagcctttatgaatggcagtgcactggaacatgtggta
gagttcggcttagattatccagaaggcatggcagtggactggcttgggaagaacttgtac
tgggcagacacaggaacaaatagaattgaggtgtcaaagttggatgggcagcaccgacaa
gttttggtgtggaaagacctagatagtcccagagctcttgcgttggaccctgctgaagga
tttatgtattggaccgagtggggtggaaaacctaagatagacagagctgccatggatgga
agtgagcgtactacattagttccgaacgtgggacgtgcaaatggcctaactattgattat
gctaaaaggaggctctattggacagacctggacaccaacttaatagaatcttcaaatatg
cttggactcaaccgtgaagttatagcagatgacttgcctcatccttttggcttaactcag
taccaagattacatctattggacggactggagccgacgcagcattgaacgtgccaacaaa
actagtggccaaaaccgcaccatcattcaaggccatttggattatgtgatggacatcctc
gtctttcattcctctcggcaggcaggatggaatgagtgtgcttccagcaatgggcactgc
tcccacctctgcttggctgtgccagttggaggttttgtttgtggatgccctgcccactac
tctcttaattctgacaacaggacttgtagtgctccaactactttcctgctcttcagtcag
aagagtgccattaaccgcatggtgattgatgaacaacagagccccgatatcatccttccc
attcacagccttcgaaatgtccgggccattgactatgacccactggacaagcaactctat
tggattgactcacgacaaaacatgatccgaaaagcacaagaagatggtagccagggcttt
actgtggtggtaagctcagttcctaatcagaacctagaaatacaaccctatgacctcagc
attgatatttatagccgctatatctactggacttgtgaggctaccaatgtcatcaacgta
acaagattagatggaagatcaattggagtggtgctaaaaggggagcaagacagaccgcga
gccattgtggtaaatccagagaaagggtatatgtattttactaatcttcaggaaagatct
cccaaaattgaacgagctgctttggatggaacagaacgagaggtcctctttttcagtggc
ttaagtaaaccaattgctttagcccttgatagccgattgggcaaactcttttgggctgat
tcagatctccggcgaattgaaagcagtgatctctcaggtgccaaccggatagtattagaa
gactccaatatcttgcagcctgtgggactgactgtatttgaaaattggctatattggatt
gataagcagcagcaaatgattgaaaaaattgacatgacaggtcgagagggtagaactaaa
gtccaggctcgaattgcccagcttagtgatattcatgcagtaaaggagctgaaccttcag
gaatatagacaacatccatgtgctcaggataatggtggctgttcacacatttgtcttgta
aaaggagatggtactacaaggtgttcttgccccatgcacttggttctgcttcaagatgag
ctgtcatgtggagaacccccaacatgttctcctcagcagtttacctgtttcacgggagaa
attgactgtatccctgtagcttggcgttgcgatggatttactgaatgtgaagaccatagt
gatgagctcaattgtcctgtgtgctcagaatcccagttccagtgtgccagtgggcaatgt
attgatggtgccctccgatgcaatggagatgcaaactgccaggataaatcagatgagaag
aactgtgaagtgctttgtttaattgatcagtttcgctgtgccaatggtcagtgcattgga
aaacataagaaatgtgatcataatgtggattgcagtgacaaatcagatgaagtggattgt
tatccaactgaggagccaacaccacaggccaccaatacagttggttcagtcattggtgtc
attgtcaccattttcgtgtctggaaccatatactttatctgccagaggatgttgtgtcca
cgtatgaagggagatggggaaaccatgactaatgactatgtagttcatggaccagcttct
gtgccccttggttatgtgccacacccaggttctttatcaggatctcttccaggaatgtct
cgaggtaaatcaatgatcagctcccttagtatcatggggggaagcagcggacccccttat
gaccgagctcatgtcacaggagcatcatcaagtagttcttcaagcaccaaaggcacttac
ttccctgcaattttgaaccctccaccatccccagccacagagcgatcacattacactatg
gaatttggttattcttcaaatagtccttccactcataggtcctacagctacaggccatac
agttaccggcactttgcaccccccaccacaccctgcagtacagatgtttgtgacagtgac
tatgctcccagccggagaatgacctcagtggcaacagccaagggctacaccagtgacttg
aactatgactcagagcctgtgcccccacctcccacaccccgaagccaatacttgtcagca
gaagagaactatgaaagctgcccaccttctccatacacagagaggagttactctcatcac
ctctacccaccgccaccctctccctgtacagactcctcctga

DBGET integrated database retrieval system