KEGG   Rousettus aegyptiacus (Egyptian rousette): 107503560
Entry
107503560         CDS       T06036                                 

Gene name
SLC9A1
Definition
(RefSeq) sodium/hydrogen exchanger 1
  KO
K05742  solute carrier family 9 (sodium/hydrogen exchanger), member 1
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04024  cAMP signaling pathway
ray04260  Cardiac muscle contraction
ray04261  Adrenergic signaling in cardiomyocytes
ray04371  Apelin signaling pathway
ray04810  Regulation of actin cytoskeleton
ray04919  Thyroid hormone signaling pathway
ray04970  Salivary secretion
ray04971  Gastric acid secretion
ray04972  Pancreatic secretion
ray04976  Bile secretion
ray05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    107503560 (SLC9A1)
   04024 cAMP signaling pathway
    107503560 (SLC9A1)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107503560 (SLC9A1)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    107503560 (SLC9A1)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    107503560 (SLC9A1)
   04261 Adrenergic signaling in cardiomyocytes
    107503560 (SLC9A1)
  09154 Digestive system
   04970 Salivary secretion
    107503560 (SLC9A1)
   04971 Gastric acid secretion
    107503560 (SLC9A1)
   04972 Pancreatic secretion
    107503560 (SLC9A1)
   04976 Bile secretion
    107503560 (SLC9A1)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    107503560 (SLC9A1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:ray01009]
    107503560 (SLC9A1)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ray02000]
    107503560 (SLC9A1)
Protein phosphatases and associated proteins [BR:ray01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     107503560 (SLC9A1)
Transporters [BR:ray02000]
 Solute carrier family (SLC)
  SLC9: Na+/H+ exchanger
   107503560 (SLC9A1)
SSDB
Motif
Pfam: Na_H_Exchanger NEXCaM_BD OprF
Other DBs
NCBI-GeneID: 107503560
NCBI-ProteinID: XP_015987547
LinkDB
Position
Unknown
AA seq 814 aa
MLSWSGIGGLSPPRIFPSLLIGVALVGLLPVLRSHGLQSSPTASTIRGSEPPRERSIGDV
TTAPPELIPDSRPVNHSVTEHSMKARKAFPVLGIDYHHVRTPFEISLWILLACLMKIGFH
VIPTISSIVPESCLLIVVGLLVGGLIKGVGETPPFLQSEVFFLFLLPPIILDAGYFLPLR
QFTENLGTILIFAVVGTLWNAFFLGGLMYAVCLVGGEQINNIGLLANLLFGSIISAVDPV
AVLAVFEEIHINELLHILVFGESLLNDAVTVVLYHLFEEFANYDRIGIVDIVLGFLSFFV
VSLGGVFVGVVYGVIAAFTSRFTSHIRVIEPLFVFLYSYMAYLSAELFHLSGIMALIASG
VVMRPYVEANISHKSHTTIKYFLKMWSSVSETLIFIFLGVSTVAGSHHWNWTFVISTLLF
CLIARVLGVLGLTWFINKFRIVKLTPKDQFIIAYGGLRGAIAFSLGYLLDKKHFPMCDLF
LTAIITVIFFTVFVQGMTIRPLVDLLAVKKKQETKRSINEEIHTQFLDHLLTGIEDICGH
YGHHHWKDKLNRFNKKYVKKCLIAGERSKEPQLIAFYHKMEMKQAIELVESGGMGKIPSA
VSTVSMQNIHPKSLPAERILPALSKDKEEEIRKILRNNLQKTRQRLRSYNRHTLVADPYE
EAWNQMLLRRQKARQLEQKINNYLTVPAHKLDSPTMSRARIGSDPLAYEPKADLPVITID
PASPQSPESVDLVNEELKGKVLGLNRDPRVAEDDEDDDGGIMIRTKEPSSPGTDDVFTPG
PSDSPSSQRIQRCLSDPGPHPEPGEGEPFIPKGQ
NT seq 2445 nt   +upstreamnt  +downstreamnt
atgctttcgtggtctggcattggtggcctctctccacctcgaatcttcccttcgttgctc
ataggggtagccttggtggggctgctacctgttctcaggagccatggcctccagtccagc
cctactgccagcaccatccgaggctccgagccaccacgggaacgctctattggagatgtc
accactgccccaccggagctcatccccgacagccgccctgttaaccattctgtcactgaa
catagcatgaaggctcgaaaggcctttccagtcctgggcatcgactaccaccatgtgcgc
acacccttcgagatctccctctggatcctgctggcctgcctcatgaagataggtttccat
gtgatccccactatctcgagcatcgtcccggagagctgcctgctgatcgtggtggggctg
ttggtagggggcctgatcaagggtgtgggcgagacaccccccttcctgcagtcagaagtc
ttcttcctcttcctgctgccacccatcatcctggacgcaggctacttcctgccattgcgg
cagtttacagagaacctgggcaccatccttatcttcgccgtggtgggcacactatggaat
gccttcttcctgggtggcctcatgtacgctgtgtgcctggtgggcggcgagcagatcaac
aacattggcctcctggccaacctgctcttcggcagcatcatctcggccgtggaccccgtg
gctgtgctggccgtcttcgaggaaattcacatcaacgagctgctacatatcctcgtcttc
ggggagtccctgctcaatgacgctgtcactgtggtcctgtatcacctctttgaggagttt
gccaactacgaccgcataggcatcgtggacatcgtcctcggcttcttgagcttcttcgtg
gtgtccctgggcggagtctttgtgggcgtggtctacggggtcatcgctgccttcacctcc
cgattcacctcccacatccgcgtcatcgagccgctcttcgtcttcctctacagctacatg
gcctacctgtctgccgagctcttccacctttcaggcatcatggcgctcatcgcctcggga
gtggtgatgcgcccctacgtggaggccaacatctctcataagtcccacacgaccatcaag
tatttcctgaagatgtggagcagcgtcagtgagaccctcatcttcatcttcctcggcgtc
tccaccgtggctggctcccaccactggaactggacctttgtcatcagcaccctgctcttt
tgcctcatcgctcgcgtgctgggcgtgctgggcctgacctggttcatcaacaagtttcgc
atcgtgaagctgacccccaaggaccagttcatcattgcctatgggggcctgcgaggggcc
atcgccttctccctgggctacctcctggacaagaagcacttccccatgtgtgacctgttc
ctcactgccatcatcaccgtcatcttcttcaccgtctttgtgcagggcatgaccattcgg
cccctggtcgacctgttggctgtgaagaaaaagcaagaaacaaagcgctccatcaatgag
gagatccacacacagttcctggaccaccttctgacaggcatcgaggacatctgtggccac
tacggccaccaccactggaaggacaagctcaaccgctttaataagaagtacgtgaagaag
tgtctgatagccggcgagcgctccaaggagccccagctcatcgctttctaccacaagatg
gagatgaagcaggcgatcgagctggtggagagtggcggcatgggcaagatcccctcagct
gtctctaccgtttccatgcagaacattcaccccaagtccctgcctgctgagcgcatcctg
ccagcactctccaaggacaaggaagaggagatccgcaaaatcctgaggaacaacctgcag
aagaccaggcagcggctgcgatcttacaacaggcacacgctggtggcggacccctacgag
gaggcctggaaccagatgcttctccgcagacagaaagcccggcagctggagcagaagatc
aacaactacctgacggtgccggcccacaagctggactcacccaccatgtctcgggcccgc
attggctcagacccgctggcctatgagccgaaagccgacttgcctgttatcaccatcgac
ccagcctccccgcagtcgcccgagtctgtggacctggtgaatgaggagctgaagggcaag
gtccttgggctgaaccgggaccccagggtggccgaggacgacgaggacgatgacgggggc
attatgatacggaccaaggagccctcttccccaggcaccgacgatgtcttcacccctggg
ccaagtgacagccccagctcccagaggatacagcgctgcctcagtgacccaggcccccac
cctgagcctggggagggagagcccttcatccccaaggggcagtag

DBGET integrated database retrieval system