KEGG   Rousettus aegyptiacus (Egyptian rousette): 107503682
Entry
107503682         CDS       T06036                                 

Gene name
RPS6KB2
Definition
(RefSeq) ribosomal protein S6 kinase beta-2 isoform X1
  KO
K04688  ribosomal protein S6 kinase beta [EC:2.7.11.1]
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray01521  EGFR tyrosine kinase inhibitor resistance
ray01522  Endocrine resistance
ray04012  ErbB signaling pathway
ray04066  HIF-1 signaling pathway
ray04140  Autophagy - animal
ray04150  mTOR signaling pathway
ray04151  PI3K-Akt signaling pathway
ray04152  AMPK signaling pathway
ray04211  Longevity regulating pathway
ray04213  Longevity regulating pathway - multiple species
ray04350  TGF-beta signaling pathway
ray04371  Apelin signaling pathway
ray04666  Fc gamma R-mediated phagocytosis
ray04714  Thermogenesis
ray04910  Insulin signaling pathway
ray04931  Insulin resistance
ray05163  Human cytomegalovirus infection
ray05165  Human papillomavirus infection
ray05170  Human immunodeficiency virus 1 infection
ray05200  Pathways in cancer
ray05205  Proteoglycans in cancer
ray05210  Colorectal cancer
ray05212  Pancreatic cancer
ray05221  Acute myeloid leukemia
ray05224  Breast cancer
ray05225  Hepatocellular carcinoma
ray05226  Gastric cancer
ray05231  Choline metabolism in cancer
ray05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    107503682 (RPS6KB2)
   04350 TGF-beta signaling pathway
    107503682 (RPS6KB2)
   04371 Apelin signaling pathway
    107503682 (RPS6KB2)
   04066 HIF-1 signaling pathway
    107503682 (RPS6KB2)
   04151 PI3K-Akt signaling pathway
    107503682 (RPS6KB2)
   04152 AMPK signaling pathway
    107503682 (RPS6KB2)
   04150 mTOR signaling pathway
    107503682 (RPS6KB2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    107503682 (RPS6KB2)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    107503682 (RPS6KB2)
  09152 Endocrine system
   04910 Insulin signaling pathway
    107503682 (RPS6KB2)
  09149 Aging
   04211 Longevity regulating pathway
    107503682 (RPS6KB2)
   04213 Longevity regulating pathway - multiple species
    107503682 (RPS6KB2)
  09159 Environmental adaptation
   04714 Thermogenesis
    107503682 (RPS6KB2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107503682 (RPS6KB2)
   05205 Proteoglycans in cancer
    107503682 (RPS6KB2)
   05231 Choline metabolism in cancer
    107503682 (RPS6KB2)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    107503682 (RPS6KB2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    107503682 (RPS6KB2)
   05212 Pancreatic cancer
    107503682 (RPS6KB2)
   05225 Hepatocellular carcinoma
    107503682 (RPS6KB2)
   05226 Gastric cancer
    107503682 (RPS6KB2)
   05221 Acute myeloid leukemia
    107503682 (RPS6KB2)
   05224 Breast cancer
    107503682 (RPS6KB2)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    107503682 (RPS6KB2)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    107503682 (RPS6KB2)
   05163 Human cytomegalovirus infection
    107503682 (RPS6KB2)
   05165 Human papillomavirus infection
    107503682 (RPS6KB2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    107503682 (RPS6KB2)
   01522 Endocrine resistance
    107503682 (RPS6KB2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ray01001]
    107503682 (RPS6KB2)
Enzymes [BR:ray01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     107503682 (RPS6KB2)
Protein kinases [BR:ray01001]
 Serine/threonine kinases: AGC group
  RSK family [OT]
   107503682 (RPS6KB2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_C Kinase-like Pkinase_fungal Seadorna_VP7 Kdo
Other DBs
NCBI-GeneID: 107503682
NCBI-ProteinID: XP_015987805
LinkDB
Position
Unknown
AA seq 483 aa
MAAVFDLDLETEEGSEGEGEPEFSPADVCPLAELRAAGLEPVGHYEEVELTETSVNLGPE
RIGPHCFELLRVLGKGGYGKVFQVRKVQGSNLGKIYAMKVLRKAKIVRNAKDTAHTRAER
NILESVKHPFIVELAYAFQTGGKLYLILECLSGGELFTHLEREGIFLEDTACFYLAEITL
ALGHLHSQGIIYRDLKPENIMLNSQGHIKLTDFGLCKESIHEGAVTHTFCGTIEYMAPEI
LVRSGHNRAVDWWSLGALMYDMLTGSPPFTAENRKKTMDKIIKGKLVLPPYLTPDARDLV
KKFLKRNPSQRIGGGPGDAADVQRHPFFRHINWDDLLARRVDPPFRPCLQSEDDVSQFDT
RFTRQTPVDSPDDTALSESANQAFLGFTYVAPSVLDSIREGFSFQPKLRSPRRLNSSPRT
PISPLKFSPFEVFRPSPGPPEPMEPPLPPLLPPPPPPSSTAPLPIQPPSGTKKSKRGRGR
PGR
NT seq 1452 nt   +upstreamnt  +downstreamnt
atggcggcggtgtttgacctggatctggagacggaggaaggcagcgagggcgagggcgag
ccagagttcagccctgcggatgtgtgtccccttgccgagttgagggctgctggcctggag
cctgtgggacactatgaggaggtggagctgactgaaaccagtgtgaacctgggccctgag
cgcattggaccccactgctttgagctgctgcgtgtgctgggcaagggcggctatggcaag
gtgttccaggtgcgaaaggtgcagggcagcaacttggggaaaatatacgccatgaaagtc
ctgaggaaggccaaaatcgtgcgcaacgccaaggacacggcacacacacgggccgagcgg
aacattctagagtccgtgaagcaccccttcattgtggaactggcctacgccttccagact
ggtggcaaactctacctcatcctcgagtgcctcagtggtggcgagctcttcacacatctt
gagcgagagggcatcttcctggaagacacggcctgtttctacctggcagagatcacattg
gccctgggtcacctgcactcccaaggcatcatctaccgggacctcaaaccggagaacatc
atgctcaacagccagggccacatcaaactgacggactttggactctgcaaggagtcgatt
cacgagggcgctgtcacccacaccttctgtggcaccattgagtacatggcccctgagatt
ctggtgcgcagtggccacaaccgggcggtggactggtggagcctgggggccctgatgtac
gacatgctcactggatcgccacccttcactgcggagaatcggaagaagactatggacaag
atcatcaaagggaagctggtgctgcctccgtacctcaccccggatgcccgcgacctcgtc
aaaaagttcctgaagcggaatcccagccagcggatcgggggcggccccggggacgctgcc
gatgtgcagaggcaccccttttttcggcacattaattgggacgatctcctggcccgccgc
gtggacccccctttccggccctgtctgcagtcagaggacgacgtgagccagtttgacacc
cgcttcacacggcagacgccagtggacagcccggacgacacagccctcagcgagagcgcc
aaccaggccttcctgggcttcacgtacgtggcgccctccgtcctggacagcatcagagag
ggcttctccttccagcccaaactgcgctcccccagacgcctcaacagcagcccccggacc
cccatcagccccctgaagttctcaccctttgaggtgttccggcctagccctggcccaccg
gagcccatggagccccctttacctcctctcctgccgccgccgccgccgccctcgagcact
gcccccctccccatccaacccccctcggggaccaagaagtctaagaggggtcgcgggcgc
cctgggcgctag

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107510136
Entry
107510136         CDS       T06036                                 

Gene name
RPS6KB1
Definition
(RefSeq) ribosomal protein S6 kinase beta-1 isoform X1
  KO
K04688  ribosomal protein S6 kinase beta [EC:2.7.11.1]
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray01521  EGFR tyrosine kinase inhibitor resistance
ray01522  Endocrine resistance
ray04012  ErbB signaling pathway
ray04066  HIF-1 signaling pathway
ray04140  Autophagy - animal
ray04150  mTOR signaling pathway
ray04151  PI3K-Akt signaling pathway
ray04152  AMPK signaling pathway
ray04211  Longevity regulating pathway
ray04213  Longevity regulating pathway - multiple species
ray04350  TGF-beta signaling pathway
ray04371  Apelin signaling pathway
ray04666  Fc gamma R-mediated phagocytosis
ray04714  Thermogenesis
ray04910  Insulin signaling pathway
ray04931  Insulin resistance
ray05163  Human cytomegalovirus infection
ray05165  Human papillomavirus infection
ray05170  Human immunodeficiency virus 1 infection
ray05200  Pathways in cancer
ray05205  Proteoglycans in cancer
ray05210  Colorectal cancer
ray05212  Pancreatic cancer
ray05221  Acute myeloid leukemia
ray05224  Breast cancer
ray05225  Hepatocellular carcinoma
ray05226  Gastric cancer
ray05231  Choline metabolism in cancer
ray05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    107510136 (RPS6KB1)
   04350 TGF-beta signaling pathway
    107510136 (RPS6KB1)
   04371 Apelin signaling pathway
    107510136 (RPS6KB1)
   04066 HIF-1 signaling pathway
    107510136 (RPS6KB1)
   04151 PI3K-Akt signaling pathway
    107510136 (RPS6KB1)
   04152 AMPK signaling pathway
    107510136 (RPS6KB1)
   04150 mTOR signaling pathway
    107510136 (RPS6KB1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    107510136 (RPS6KB1)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    107510136 (RPS6KB1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    107510136 (RPS6KB1)
  09149 Aging
   04211 Longevity regulating pathway
    107510136 (RPS6KB1)
   04213 Longevity regulating pathway - multiple species
    107510136 (RPS6KB1)
  09159 Environmental adaptation
   04714 Thermogenesis
    107510136 (RPS6KB1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107510136 (RPS6KB1)
   05205 Proteoglycans in cancer
    107510136 (RPS6KB1)
   05231 Choline metabolism in cancer
    107510136 (RPS6KB1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    107510136 (RPS6KB1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    107510136 (RPS6KB1)
   05212 Pancreatic cancer
    107510136 (RPS6KB1)
   05225 Hepatocellular carcinoma
    107510136 (RPS6KB1)
   05226 Gastric cancer
    107510136 (RPS6KB1)
   05221 Acute myeloid leukemia
    107510136 (RPS6KB1)
   05224 Breast cancer
    107510136 (RPS6KB1)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    107510136 (RPS6KB1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    107510136 (RPS6KB1)
   05163 Human cytomegalovirus infection
    107510136 (RPS6KB1)
   05165 Human papillomavirus infection
    107510136 (RPS6KB1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    107510136 (RPS6KB1)
   01522 Endocrine resistance
    107510136 (RPS6KB1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ray01001]
    107510136 (RPS6KB1)
Enzymes [BR:ray01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     107510136 (RPS6KB1)
Protein kinases [BR:ray01001]
 Serine/threonine kinases: AGC group
  RSK family [OT]
   107510136 (RPS6KB1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_C Kinase-like Pkinase_fungal APH
Other DBs
NCBI-GeneID: 107510136
NCBI-ProteinID: XP_015998875
LinkDB
Position
Unknown
AA seq 525 aa
MRRRRRRDGFYPAPDFRDREAEDMAGVFDIDLDQPEDAGSEDELEEGGQLNESMDHGGVG
PYELGMEHCEKFEISETSVNRGPEKIRPECFELLRVLGKGGYGKVFQVRKVTGANTGKIF
AMKVLKKAMIVRNAKDTAHTKAERNILEEVKHPFIVDLIYAFQTGGKLYLILEYLSGGEL
FMQLEREGIFMEDTACFYLAEISMALGHLHQKGIIYRDLKPENIMLNHQGHVKLTDFGLC
KESIHDGTVTHTFCGTIEYMAPEILMRSGHNRAVDWWSLGALMYDMLTGAPPFTGENRKK
TIDKILKCKLNLPPYLTQEARDLLKKLLKRNAASRLGAGPGDAGEVQAHPFFRHINWEEL
LGRKVEPPFKPLLQSEEDVSQFDSKFTRQTPVDSPDDSTLSESANQVFLGFTYVAPSVLE
SVKEKFSFEPKIRSPRRFIGSPRTPVSPVKFSPGDFWGRGASASTANPQTPVEYPMETSG
VEQMDVTMSGEASAPLPIRQPNTGPYKKQAFPMISKRPEHLRMNL
NT seq 1578 nt   +upstreamnt  +downstreamnt
atgaggcgacgacggaggcgggacggcttttacccagcgccggacttccgagacagggaa
gctgaggacatggcaggagtgtttgacatagacctagaccagccagaggacgcgggctct
gaggatgagctggaggaggggggtcagttaaatgaaagcatggaccatgggggagttgga
ccatatgaacttggcatggaacattgtgagaaatttgaaatctcagaaactagtgtgaac
agagggccagaaaaaatcagaccagaatgttttgagctacttcgggtacttggtaaaggg
ggctatggaaaggtttttcaagtacgaaaagtaacaggagcaaatactgggaaaatattt
gccatgaaggtgcttaaaaaggcaatgatagtaagaaatgctaaagatacagctcataca
aaagcagaacggaatattctggaggaagtaaaacatcccttcattgtggatttaatttat
gcctttcagactggtggaaaactctacctcatccttgagtatctcagcgggggagaatta
tttatgcagttagaaagagaaggaatatttatggaagatacagcctgcttttacttggca
gaaatctccatggctttggggcatttacatcaaaaggggatcatctacagagacctgaag
ccggagaatatcatgcttaatcaccaaggtcatgtgaaactaacagactttggactatgc
aaagaatctattcatgatggaacagtcacacacacattttgtggaacaatagaatacatg
gcccctgaaatcttgatgagaagtggccacaatcgtgctgtggattggtggagtttggga
gcattaatgtatgacatgctgactggagcacccccattcactggggagaatagaaagaaa
acaattgacaaaatcctcaaatgtaaactcaatttgcctccctacctcacacaagaagcc
agagatctgcttaaaaagctgctgaaaagaaatgctgcttctcgtcttggagctggtcct
ggggatgctggagaagttcaggctcatccattcttcagacatattaactgggaagaactg
ctgggtaggaaggtggagcccccctttaaacctctgttgcaatctgaagaggatgtgagt
cagtttgattcaaagtttacacgtcagacacctgttgacagcccagatgactcaactctc
agtgaaagtgccaaccaggtctttctgggttttacatatgtggctccatctgtacttgaa
agcgtgaaagaaaagttttcctttgaaccaaaaatccgatcacctcgaagatttattggc
agcccacgaacacctgtcagcccagtcaaattttctcctggggatttctggggaagaggt
gcttcagccagcacagcaaatcctcagacgcctgtggaatacccaatggaaacaagtgga
gtagaacagatggatgtgacgatgagtggggaagcttcagccccacttccaatacgacaa
ccgaacaccgggccatacaaaaaacaggcttttcccatgatatccaaacgaccagagcac
ctgcgtatgaatctatga

DBGET integrated database retrieval system