KEGG   Rousettus aegyptiacus (Egyptian rousette): 107503728
Entry
107503728         CDS       T06036                                 

Gene name
PPP1CA
Definition
(RefSeq) serine/threonine-protein phosphatase PP1-alpha catalytic subunit
  KO
K06269  serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray03015  mRNA surveillance pathway
ray04022  cGMP-PKG signaling pathway
ray04024  cAMP signaling pathway
ray04114  Oocyte meiosis
ray04218  Cellular senescence
ray04261  Adrenergic signaling in cardiomyocytes
ray04270  Vascular smooth muscle contraction
ray04390  Hippo signaling pathway
ray04510  Focal adhesion
ray04611  Platelet activation
ray04720  Long-term potentiation
ray04728  Dopaminergic synapse
ray04750  Inflammatory mediator regulation of TRP channels
ray04810  Regulation of actin cytoskeleton
ray04910  Insulin signaling pathway
ray04921  Oxytocin signaling pathway
ray04931  Insulin resistance
ray05031  Amphetamine addiction
ray05034  Alcoholism
ray05168  Herpes simplex virus 1 infection
ray05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:ray00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    107503728 (PPP1CA)
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    107503728 (PPP1CA)
   04024 cAMP signaling pathway
    107503728 (PPP1CA)
   04022 cGMP-PKG signaling pathway
    107503728 (PPP1CA)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    107503728 (PPP1CA)
   04218 Cellular senescence
    107503728 (PPP1CA)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107503728 (PPP1CA)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107503728 (PPP1CA)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    107503728 (PPP1CA)
  09152 Endocrine system
   04910 Insulin signaling pathway
    107503728 (PPP1CA)
   04921 Oxytocin signaling pathway
    107503728 (PPP1CA)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107503728 (PPP1CA)
   04270 Vascular smooth muscle contraction
    107503728 (PPP1CA)
  09156 Nervous system
   04728 Dopaminergic synapse
    107503728 (PPP1CA)
   04720 Long-term potentiation
    107503728 (PPP1CA)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    107503728 (PPP1CA)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    107503728 (PPP1CA)
  09165 Substance dependence
   05031 Amphetamine addiction
    107503728 (PPP1CA)
   05034 Alcoholism
    107503728 (PPP1CA)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    107503728 (PPP1CA)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    107503728 (PPP1CA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:ray01009]
    107503728 (PPP1CA)
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:ray03021]
    107503728 (PPP1CA)
   03019 Messenger RNA biogenesis [BR:ray03019]
    107503728 (PPP1CA)
   03041 Spliceosome [BR:ray03041]
    107503728 (PPP1CA)
Enzymes [BR:ray01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     107503728 (PPP1CA)
Protein phosphatases and associated proteins [BR:ray01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    Catalytic subunits
     107503728 (PPP1CA)
Transcription machinery [BR:ray03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Transcription termination factor
     107503728 (PPP1CA)
Messenger RNA biogenesis [BR:ray03019]
 Eukaryotic type
  mRNA processing factors
   3' end processing
    Cleavage and polyadenylation specificity factor (CPSF) complex
     107503728 (PPP1CA)
Spliceosome [BR:ray03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    107503728 (PPP1CA)
SSDB
Motif
Pfam: Metallophos STPPase_N
Other DBs
NCBI-GeneID: 107503728
NCBI-ProteinID: XP_015987913
LinkDB
Position
Unknown
AA seq 330 aa
MTDSEKLNLDSIIGRLLEVQGSRPGKNVQLTENEIRGLCLKSREIFLSQPILLELEAPLK
ICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFL
LRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDL
QSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVQGWGENDRGVSFTFGAEVVAKFLHKHD
LDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAD
KNKGKYGQFSGLNPGGRPITPPRNSAKAKK
NT seq 993 nt   +upstreamnt  +downstreamnt
atgaccgacagcgagaagctcaacctggactctatcatcgggcgcctgctcgaagtgcag
ggctcccggcctggaaagaatgtacagctgacagagaacgaaatccgtggtctgtgtctt
aaatcccgggagattttcctgagccagcccattcttctggagctggaggcacccctcaag
atctgcggtgacatccatggccagtactatgaccttctgcggctgttcgagtatggcggc
ttccctccggaaagcaactacctctttctgggggactatgtggaccgaggcaagcagtcg
ctggagaccatctgtctgctgctggcctataagatcaagtaccctgagaacttcttcctg
ctccgtgggaaccatgagtgtgccagcatcaaccgcatctatggcttctacgatgagtgc
aagagacgctacaacattaaactgtggaaaaccttcactgactgcttcaactgcctgccc
atcgctgccatcgtggatgagaagatcttctgctgccacggaggcctgtccccggacctg
caatccatggaacagattcggcgtatcatgcggcccactgatgtgcctgaccaggggttg
ttatgtgacctgctgtggtctgaccctgacaaggacgtgcagggctggggcgagaacgac
cgtggtgtctcctttacttttggggccgaggtggtggccaagttcctgcacaagcacgac
ttggacctcatctgccgggcgcaccaggtggtagaagatggctacgagttctttgccaag
cggcagctggtgacactcttctcagctcccaactactgtggcgagtttgacaacgcaggc
gccatgatgagtgtggacgagacactgatgtgctccttccagatcctaaaacccgccgac
aagaacaaggggaaatacgggcagttcagtggcctgaaccctggcggccggcccatcacc
ccgccccgcaactccgccaaagccaagaaatag

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107511165
Entry
107511165         CDS       T06036                                 

Gene name
PPP1CB
Definition
(RefSeq) serine/threonine-protein phosphatase PP1-beta catalytic subunit
  KO
K06269  serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray03015  mRNA surveillance pathway
ray04022  cGMP-PKG signaling pathway
ray04024  cAMP signaling pathway
ray04114  Oocyte meiosis
ray04218  Cellular senescence
ray04261  Adrenergic signaling in cardiomyocytes
ray04270  Vascular smooth muscle contraction
ray04390  Hippo signaling pathway
ray04510  Focal adhesion
ray04611  Platelet activation
ray04720  Long-term potentiation
ray04728  Dopaminergic synapse
ray04750  Inflammatory mediator regulation of TRP channels
ray04810  Regulation of actin cytoskeleton
ray04910  Insulin signaling pathway
ray04921  Oxytocin signaling pathway
ray04931  Insulin resistance
ray05031  Amphetamine addiction
ray05034  Alcoholism
ray05168  Herpes simplex virus 1 infection
ray05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:ray00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    107511165 (PPP1CB)
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    107511165 (PPP1CB)
   04024 cAMP signaling pathway
    107511165 (PPP1CB)
   04022 cGMP-PKG signaling pathway
    107511165 (PPP1CB)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    107511165 (PPP1CB)
   04218 Cellular senescence
    107511165 (PPP1CB)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107511165 (PPP1CB)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107511165 (PPP1CB)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    107511165 (PPP1CB)
  09152 Endocrine system
   04910 Insulin signaling pathway
    107511165 (PPP1CB)
   04921 Oxytocin signaling pathway
    107511165 (PPP1CB)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107511165 (PPP1CB)
   04270 Vascular smooth muscle contraction
    107511165 (PPP1CB)
  09156 Nervous system
   04728 Dopaminergic synapse
    107511165 (PPP1CB)
   04720 Long-term potentiation
    107511165 (PPP1CB)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    107511165 (PPP1CB)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    107511165 (PPP1CB)
  09165 Substance dependence
   05031 Amphetamine addiction
    107511165 (PPP1CB)
   05034 Alcoholism
    107511165 (PPP1CB)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    107511165 (PPP1CB)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    107511165 (PPP1CB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:ray01009]
    107511165 (PPP1CB)
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:ray03021]
    107511165 (PPP1CB)
   03019 Messenger RNA biogenesis [BR:ray03019]
    107511165 (PPP1CB)
   03041 Spliceosome [BR:ray03041]
    107511165 (PPP1CB)
Enzymes [BR:ray01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     107511165 (PPP1CB)
Protein phosphatases and associated proteins [BR:ray01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    Catalytic subunits
     107511165 (PPP1CB)
Transcription machinery [BR:ray03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Transcription termination factor
     107511165 (PPP1CB)
Messenger RNA biogenesis [BR:ray03019]
 Eukaryotic type
  mRNA processing factors
   3' end processing
    Cleavage and polyadenylation specificity factor (CPSF) complex
     107511165 (PPP1CB)
Spliceosome [BR:ray03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    107511165 (PPP1CB)
SSDB
Motif
Pfam: Metallophos STPPase_N
Other DBs
NCBI-GeneID: 107511165
NCBI-ProteinID: XP_016000824
LinkDB
Position
Unknown
AA seq 327 aa
MADGELNVDSLITRLLEVRGCRPGKIVQMTEAEVRGLCIKSREIFLSQPILLELEAPLKI
CGDIHGQYTDLLRLFEYGGFPPEANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLL
RGNHECASINRIYGFYDECKRRFNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQ
SMEQIRRIMRPTDVPDTGLLCDLLWSDPDKDVQGWGENDRGVSFTFGADVVSKFLNRHDL
DLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGGMMSVDETLMCSFQILKPSEK
KAKYQYGGLNSGRPVTPPRTANPPKKR
NT seq 984 nt   +upstreamnt  +downstreamnt
atggcggacggggagctgaacgtggacagtctcatcacccgactgctggaggtacgagga
tgtcgtccgggaaaaattgtgcagatgactgaagcagaagttcgaggcttatgtatcaag
tctcgggagatctttctcagccagcccattcttttggaattggaagcaccgctgaaaatt
tgtggagatattcatggacagtatacagatttattgcgattatttgaatatggaggtttc
ccaccggaagccaactatcttttcttaggagattatgtggacagaggaaagcagtctttg
gaaaccatttgtttgctcttggcttataaaatcaaatacccagagaacttctttctcttg
agaggaaaccatgagtgtgctagcatcaatcgcatttatggattttatgatgaatgcaaa
cgaaggtttaatattaaattgtggaagaccttcactgattgtttcaactgtctgcccata
gctgccattgtggatgagaagatcttctgttgtcatggaggactgtcaccagacctgcaa
tctatggagcagattcggagaattatgagacccactgatgtccctgatacaggtttgctc
tgtgatttgctgtggtcggacccagataaagatgtgcaaggatggggagaaaatgatcgt
ggtgtttccttcacttttggagctgatgtagttagtaaatttctgaatcgtcatgactta
gacttgatttgtcgagctcatcaggtggtggaagatggatatgaattttttgctaaaaga
caattggtaaccctattttcagccccaaattactgtggcgaatttgataatgctggtgga
atgatgagtgtggatgaaactttgatgtgttcatttcagatattgaaaccatctgaaaag
aaagctaagtaccagtatggtggactgaattcaggacgtcctgtcactccacctcgaaca
gctaatccaccgaagaaaaggtga

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107513247
Entry
107513247         CDS       T06036                                 

Gene name
PPP1CC
Definition
(RefSeq) serine/threonine-protein phosphatase PP1-gamma catalytic subunit
  KO
K06269  serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray03015  mRNA surveillance pathway
ray04022  cGMP-PKG signaling pathway
ray04024  cAMP signaling pathway
ray04114  Oocyte meiosis
ray04218  Cellular senescence
ray04261  Adrenergic signaling in cardiomyocytes
ray04270  Vascular smooth muscle contraction
ray04390  Hippo signaling pathway
ray04510  Focal adhesion
ray04611  Platelet activation
ray04720  Long-term potentiation
ray04728  Dopaminergic synapse
ray04750  Inflammatory mediator regulation of TRP channels
ray04810  Regulation of actin cytoskeleton
ray04910  Insulin signaling pathway
ray04921  Oxytocin signaling pathway
ray04931  Insulin resistance
ray05031  Amphetamine addiction
ray05034  Alcoholism
ray05168  Herpes simplex virus 1 infection
ray05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:ray00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    107513247 (PPP1CC)
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    107513247 (PPP1CC)
   04024 cAMP signaling pathway
    107513247 (PPP1CC)
   04022 cGMP-PKG signaling pathway
    107513247 (PPP1CC)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    107513247 (PPP1CC)
   04218 Cellular senescence
    107513247 (PPP1CC)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107513247 (PPP1CC)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107513247 (PPP1CC)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    107513247 (PPP1CC)
  09152 Endocrine system
   04910 Insulin signaling pathway
    107513247 (PPP1CC)
   04921 Oxytocin signaling pathway
    107513247 (PPP1CC)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107513247 (PPP1CC)
   04270 Vascular smooth muscle contraction
    107513247 (PPP1CC)
  09156 Nervous system
   04728 Dopaminergic synapse
    107513247 (PPP1CC)
   04720 Long-term potentiation
    107513247 (PPP1CC)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    107513247 (PPP1CC)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    107513247 (PPP1CC)
  09165 Substance dependence
   05031 Amphetamine addiction
    107513247 (PPP1CC)
   05034 Alcoholism
    107513247 (PPP1CC)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    107513247 (PPP1CC)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    107513247 (PPP1CC)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:ray01009]
    107513247 (PPP1CC)
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:ray03021]
    107513247 (PPP1CC)
   03019 Messenger RNA biogenesis [BR:ray03019]
    107513247 (PPP1CC)
   03041 Spliceosome [BR:ray03041]
    107513247 (PPP1CC)
Enzymes [BR:ray01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     107513247 (PPP1CC)
Protein phosphatases and associated proteins [BR:ray01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    Catalytic subunits
     107513247 (PPP1CC)
Transcription machinery [BR:ray03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Transcription termination factor
     107513247 (PPP1CC)
Messenger RNA biogenesis [BR:ray03019]
 Eukaryotic type
  mRNA processing factors
   3' end processing
    Cleavage and polyadenylation specificity factor (CPSF) complex
     107513247 (PPP1CC)
Spliceosome [BR:ray03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    107513247 (PPP1CC)
SSDB
Motif
Pfam: Metallophos STPPase_N
Other DBs
NCBI-GeneID: 107513247
NCBI-ProteinID: XP_016005174
LinkDB
Position
Unknown
AA seq 337 aa
MADIDKLNIDSIIQRLLEVRGSKPGKNVQLQENEIRGLCLKSREIFLSQPILLELEAPLK
ICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFL
LRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDL
QSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVLGWGENDRGVSFTFGAEVVAKFLHKHD
LDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAE
KKKPNATRPVTPPRVASGLNPSIQKASNYRNNTVLYE
NT seq 1014 nt   +upstreamnt  +downstreamnt
atggcggatatagataaactcaatatcgacagcatcatccaacggctgctggaagtgaga
gggtccaagcctggtaagaatgtccagctacaggagaatgaaatcagaggattgtgctta
aagtcccgagagatctttctcagtcagcctatcctactagaacttgaagcaccactaaaa
atatgtggtgatatccatgggcagtactatgatttgcttcgactttttgagtatggtggt
ttcccacccgaaagcaactacctgtttcttggggactatgtggacagggggaagcagtca
ttggagactatctgcctcttattggcgtacaaaatcaaatatcccgagaatttttttctt
ctcagaggaaaccatgaatgtgccagcatcaatagaatttatggattttacgatgaatgt
aaaagaagatataacattaaactatggaaaactttcacagactgctttaattgtttacca
atagcagccatcgtggatgagaaaatattttgctgtcatggaggtttatcaccagatctt
caatctatggagcagattcggcgaattatgcgaccaactgatgtaccagatcaaggtctt
ctttgtgatcttttgtggtctgaccccgataaagatgtcttaggctggggtgaaaatgac
agaggagtgtccttcacatttggtgcagaagtggttgcaaaatttctccataagcatgat
ttggatcttatatgtagagcccatcaggtggttgaagatggatatgaattttttgcaaag
aggcagttggtcactctgttttctgcacccaattattgtggagagtttgacaatgcaggt
gccatgatgagtgtggacgaaacactaatgtgttcttttcagattttaaagcctgcagag
aaaaagaagccgaatgccacaagacctgtaacacctccaagggttgcatcaggcctgaac
ccgtccattcagaaagcttcaaattatagaaacaatactgttctatacgagtga

DBGET integrated database retrieval system