KEGG   Rousettus aegyptiacus (Egyptian rousette): 107503915
Entry
107503915         CDS       T06036                                 

Gene name
BCL2
Definition
(RefSeq) apoptosis regulator Bcl-2 isoform X1
  KO
K02161  apoptosis regulator Bcl-2
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray01521  EGFR tyrosine kinase inhibitor resistance
ray01522  Endocrine resistance
ray01524  Platinum drug resistance
ray04064  NF-kappa B signaling pathway
ray04066  HIF-1 signaling pathway
ray04071  Sphingolipid signaling pathway
ray04115  p53 signaling pathway
ray04140  Autophagy - animal
ray04141  Protein processing in endoplasmic reticulum
ray04151  PI3K-Akt signaling pathway
ray04210  Apoptosis
ray04215  Apoptosis - multiple species
ray04217  Necroptosis
ray04261  Adrenergic signaling in cardiomyocytes
ray04340  Hedgehog signaling pathway
ray04510  Focal adhesion
ray04621  NOD-like receptor signaling pathway
ray04630  JAK-STAT signaling pathway
ray04722  Neurotrophin signaling pathway
ray04725  Cholinergic synapse
ray04915  Estrogen signaling pathway
ray04928  Parathyroid hormone synthesis, secretion and action
ray04933  AGE-RAGE signaling pathway in diabetic complications
ray05014  Amyotrophic lateral sclerosis
ray05022  Pathways of neurodegeneration - multiple diseases
ray05132  Salmonella infection
ray05145  Toxoplasmosis
ray05152  Tuberculosis
ray05161  Hepatitis B
ray05162  Measles
ray05168  Herpes simplex virus 1 infection
ray05169  Epstein-Barr virus infection
ray05170  Human immunodeficiency virus 1 infection
ray05200  Pathways in cancer
ray05206  MicroRNAs in cancer
ray05210  Colorectal cancer
ray05215  Prostate cancer
ray05222  Small cell lung cancer
ray05226  Gastric cancer
ray05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ray00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    107503915 (BCL2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    107503915 (BCL2)
   04630 JAK-STAT signaling pathway
    107503915 (BCL2)
   04064 NF-kappa B signaling pathway
    107503915 (BCL2)
   04066 HIF-1 signaling pathway
    107503915 (BCL2)
   04071 Sphingolipid signaling pathway
    107503915 (BCL2)
   04151 PI3K-Akt signaling pathway
    107503915 (BCL2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    107503915 (BCL2)
  09143 Cell growth and death
   04210 Apoptosis
    107503915 (BCL2)
   04215 Apoptosis - multiple species
    107503915 (BCL2)
   04217 Necroptosis
    107503915 (BCL2)
   04115 p53 signaling pathway
    107503915 (BCL2)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107503915 (BCL2)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    107503915 (BCL2)
  09152 Endocrine system
   04915 Estrogen signaling pathway
    107503915 (BCL2)
   04928 Parathyroid hormone synthesis, secretion and action
    107503915 (BCL2)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107503915 (BCL2)
  09156 Nervous system
   04725 Cholinergic synapse
    107503915 (BCL2)
   04722 Neurotrophin signaling pathway
    107503915 (BCL2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107503915 (BCL2)
   05206 MicroRNAs in cancer
    107503915 (BCL2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    107503915 (BCL2)
   05226 Gastric cancer
    107503915 (BCL2)
   05215 Prostate cancer
    107503915 (BCL2)
   05222 Small cell lung cancer
    107503915 (BCL2)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    107503915 (BCL2)
   05022 Pathways of neurodegeneration - multiple diseases
    107503915 (BCL2)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    107503915 (BCL2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    107503915 (BCL2)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107503915 (BCL2)
   05152 Tuberculosis
    107503915 (BCL2)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    107503915 (BCL2)
   05161 Hepatitis B
    107503915 (BCL2)
   05162 Measles
    107503915 (BCL2)
   05168 Herpes simplex virus 1 infection
    107503915 (BCL2)
   05169 Epstein-Barr virus infection
    107503915 (BCL2)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    107503915 (BCL2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    107503915 (BCL2)
   01524 Platinum drug resistance
    107503915 (BCL2)
   01522 Endocrine resistance
    107503915 (BCL2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:ray01009]
    107503915 (BCL2)
Protein phosphatases and associated proteins [BR:ray01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     107503915 (BCL2)
SSDB
Motif
Pfam: Bcl-2 BH4 Bcl-2_3 SNAD4 NAD1
Other DBs
NCBI-GeneID: 107503915
NCBI-ProteinID: XP_015988205
LinkDB
Position
Unknown
AA seq 260 aa
MAHAGRTGYDNREIVMKYIHYRLSQRGYEWDAGDAGAAPPGATPAPGISSSQPGRTPAPA
RTSSPPPPLAAPAGAAAGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFT
ARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDSIALWMTEYLNRHL
HTWIQDNGGWVGARPGECASGRGGGSETRWRSECGWAPGPPQADEPVKSSRVCCFLRSSP
CQQCCDHFFASKVFSLLASC
NT seq 783 nt   +upstreamnt  +downstreamnt
atggcgcacgccgggagaacagggtatgataaccgagagatagtgatgaagtacatccac
tataggctgtcgcagaggggctacgagtgggatgcgggagacgcgggcgccgcgcccccg
ggggccacccccgcgccgggcatttcgtcctcccagcccgggcgcacccccgcgcccgcc
aggacctcgtcgccgccgccgcccctggccgcccccgccggcgctgccgcggggcctgcg
ctcagccccgtaccacctgtggtccacctgaccctgcgccaggcgggtgatgacttctcc
cgtcgctaccgccgcgacttcgccgagatgtccagccagctgcacctgacgcccttcacc
gcgaggggacgctttgccacggtggtggaggagcttttcagggatggggtgaactggggg
aggattgtggccttctttgagttcggtggggtcatgtgtgtggagagcgtcaaccgggag
atgtcgcccctggtggacagcatcgccctgtggatgaccgagtacctgaaccggcacctg
cacacctggatccaggataacggaggctgggtaggtgcacgtccgggtgaatgtgcgtct
gggcggggtggcgggtctgagacgcggtggaggtcggagtgtgggtgggctcctgggcca
ccgcaggctgatgagccagtgaagtcaagtcgggtttgttgcttcctacgaagctctccc
tgccaacagtgctgtgatcatttctttgcgtccaaagtgttttccttgcttgccagctgt
tga

DBGET integrated database retrieval system