KEGG   Rousettus aegyptiacus (Egyptian rousette): 107504010
Entry
107504010         CDS       T06036                                 

Gene name
SLC4A4
Definition
(RefSeq) electrogenic sodium bicarbonate cotransporter 1 isoform X1
  KO
K13575  solute carrier family 4 (sodium bicarbonate cotransporter), member 4
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04964  Proximal tubule bicarbonate reclamation
ray04972  Pancreatic secretion
ray04976  Bile secretion
Brite
KEGG Orthology (KO) [BR:ray00001]
 09150 Organismal Systems
  09154 Digestive system
   04972 Pancreatic secretion
    107504010 (SLC4A4)
   04976 Bile secretion
    107504010 (SLC4A4)
  09155 Excretory system
   04964 Proximal tubule bicarbonate reclamation
    107504010 (SLC4A4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ray02000]
    107504010 (SLC4A4)
Transporters [BR:ray02000]
 Solute carrier family (SLC)
  SLC4: Bicarbonate transporter
   107504010 (SLC4A4)
SSDB
Motif
Pfam: HCO3_cotransp Band_3_cyto PTS_EIIA_2 Fmp27_WPPW VWA_N AP3D1
Other DBs
NCBI-GeneID: 107504010
NCBI-ProteinID: XP_015988396
LinkDB
Position
Unknown
AA seq 1146 aa
MNSSLQVNLPRSWAAPSGSLQEKSEHSFFLFYYYRMEDEAVLDRGASFLKHVCDEEEVEG
HHTIYIGVHVPKSYRRRRRHKRKTGHKEKKEKERISENYSDKSDVENADESSSSILKPLI
SPAAERIRFILGEEDDSPAPPQLFTELDELLAVDGQEMEWKETARWIKFEEKVEQGGERW
SKPHVATLSLHSLFELRTCMEKGSIMLDREASSLPQLVEMIVDHQIETGLLKPDLKDKVT
YTLLRKHRHQTKKSNLRSLADIGKTVSSASRMFTNPDNARSPLENSVPCLATRTLDDDPR
VRRTPSVGWLSSPAMTHRNLTSSSLNDISDKPEKDQLKNKFMKKLPRDAEASNVLVGEVD
FLDAPFIAFVRLQQAVMLGALTEVPVPTRFLFILLGPKGKAKSYHEIGRAIATLMSDEVF
HDIAYKAKDRQDLIAGIDEFLDEVIVLPPGEWDPAIRIEPPKSLPSSDKRKNMYSGENVQ
MNGDTPHDGGHGGGGGHGDSEELQRTGRFCGGLIKDIKRKAPFFASDFYDALNIQALSAI
LFIYLATVTNAITFGGLLGDATDNMQGVLESFLGTAVSGAIFCLFAGQPLTILSSTGPVL
VFERLLFNFSKDHNFDYLEFRLWIGLWSAFLCLILVATDASFLVQYFTRFTEEGFSSLIS
FIFIYDAFKKMIKLADYYPINSNFKVGYNTHFSCACMPPSPVNISVSNDTTLAPEDLPTM
SSTDMYRNTTFDWAVLSKKECLKYGGNLLGNNCDFVPDITLMSFILFLGTYTSSMALKKF
KTSRYFPTTARKLISDFAIILSILIFCVIDALVGVDTPKLIVPNEFKPTSPNRGWFVPPF
GGNPWWVCLAAAIPALLVTILIFMDQQITAVIVNRKEHKLKKGAGYHLDLFWVAILMVVC
SFMALPWYVAATVISIAHIDSLKMETETSAPGEQPKFLGVREQRVTGTLVFILTGLSVFM
APILKFIPMPVLYGVFLYMGVASLNGVQFMDRLKLLLMPLKHQPDFIYLRHVPLRRVHLF
TFLQVLCLALLWILKSTVAAIIFPVMILALVAVRKGMDYLFSQHDLSFLDDVIPEKDKKK
KEDEKKKKKKKGSLDSDNDDSDCPYSEQVPSIKIPMDIMEQQPFLSDSKPSDRERSPTFL
ERHTSC
NT seq 3441 nt   +upstreamnt  +downstreamnt
atgaacagcagcttgcaggttaacctgccccgaagctgggctgctccaagtggctccctg
caggagaagtctgagcattctttttttcttttttattactataggatggaggatgaagct
gtcttggacagaggggcttccttccttaagcatgtgtgtgatgaagaagaagtagaaggc
caccataccatctacattggggtccatgtgccgaagagctacaggagaaggagacgtcac
aagagaaagacggggcacaaagaaaagaaggagaaggagagaatctctgagaactactct
gacaagtcagatgtggaaaatgctgatgaatccagcagcagcatcctaaaaccactcatc
tctcctgccgcagagcgcatacgattcatcttgggtgaggaggatgacagcccagcacca
cctcagctcttcaccgaactggatgagctgctggccgtggatgggcaggagatggagtgg
aaggagacagcaaggtggattaagtttgaagaaaaagtggaacagggtggggaaagatgg
agcaagccccatgtggccacattatcccttcatagcttatttgagctgaggacgtgtatg
gagaaaggatccatcatgcttgacagagaggcttcttctctcccacagttggtggagatg
attgttgaccatcagattgagacaggccttttgaaacctgacctgaaggataaggtgacc
tatactttgctccggaagcaccggcatcaaaccaagaaatccaaccttcgatccctggct
gacattgggaagacagtctccagtgcaagtaggatgtttaccaaccctgataatgcccgc
agcccgcttgagaactcagtgccctgcctagcaacccgcaccttggacgatgaccctcga
gtgcggcgcactcccagcgtgggatggctaagtagcccagccatgacccataggaatctg
acttcctccagtctgaatgacatttctgataaaccagagaaggaccagctgaagaacaag
ttcatgaaaaagctgccccgtgacgcggaagcttctaacgtgctcgttggagaggttgac
ttcttggacgcgcctttcattgcctttgtccggctacagcaggcagtcatgctgggcgcc
ctgactgaggtccctgtgccaacgaggttcttgtttattctcttgggtcctaaggggaaa
gcgaagtcctaccatgagattggcagagccattgccaccttgatgtctgatgaggtgttc
catgacattgcttataaagcaaaagataggcaggacctgattgctggcatcgatgagttc
ctagatgaagtcattgtccttccacctggggaatgggatccagcgatcaggatagagcct
cctaagagtcttccatcgtctgacaaaagaaagaacatgtactcaggtgagaatgttcag
atgaatggggacacgccccatgacggtggccacggaggaggaggaggtcatggggacagt
gaagaactgcagaggactggacggttctgtggtggactaattaaggacataaagaggaaa
gcaccattttttgccagtgatttttatgatgctttaaatattcaggctctatcagctatt
ctcttcatttatctggcaactgtaactaatgctatcacttttggaggactgcttggggat
gccactgacaacatgcagggtgtgttggagagcttcctgggcacagctgtctctggagcc
atcttttgcctctttgctggtcagccactcactattctgagcagcacaggacctgttctc
gtatttgagaggcttctatttaatttcagcaaggaccataattttgactatttggagttt
cgcctttggattggcctgtggtcagccttcctgtgtctcattttggtagccactgatgcc
agcttcttggttcagtacttcactcgcttcactgaggagggcttctcttctctgattagc
ttcatctttatctatgatgcttttaagaagatgatcaagctagccgattactaccccatc
aactccaacttcaaagtgggctacaacactcacttttcctgtgcctgtatgcctcccagc
ccagttaatatctcagtatctaatgacactacattggctccggaggatttgccgactatg
tcttctactgacatgtaccgtaatactacctttgactgggcagttttgtcaaagaaggag
tgtctgaaatatggaggaaatctcctggggaacaactgtgattttgttcctgatatcaca
ctcatgtctttcattctcttcttgggcacctacacatcttctatggctctgaaaaaattc
aaaactagtcgttatttcccaaccacggcacgaaaactgatcagcgattttgccattatc
ttgtccattctcatcttttgtgtaatagatgccctggtaggtgtggatactccaaaatta
attgtgccaaatgagttcaagccaacaagtccaaaccgtggttggtttgttccgccattt
ggaggaaacccttggtgggtgtgccttgccgctgctatccctgctttgttggtcaccatt
ctgattttcatggatcagcaaatcacagctgtgattgtaaacaggaaagaacataaactc
aagaaaggagctgggtatcacctggatctcttttgggtggctatcctcatggtggtgtgc
tcctttatggctcttccatggtacgtggctgctactgtcatttccattgctcacattgac
agtctgaagatggagacagagacctctgcacccggagaacaaccaaagtttctcggagtg
agggaacaaagagtcactggaacccttgtgtttattctcactggtctgtcagtctttatg
gctcccatcttgaagtttattcccatgcctgtactctatggcgtgttcctgtatatgggg
gtagcatcccttaatggtgtacagttcatggatcgtctgaagctgcttctgatgcctctg
aagcatcagcctgactttatctacctgcgccatgtccccctgcgcagagtccacctgttc
actttcttgcaggtgttgtgtctagccctgctctggatcctcaagtcaactgtggctgct
atcatttttccagtcatgatcttggcacttgtagctgtcagaaaaggcatggactacctc
ttctcccagcatgacctcagcttccttgatgatgtcattccagaaaaggacaagaaaaag
aaggaagatgaaaagaaaaagaaaaagaagaaaggaagtctggatagtgataatgatgat
tctgactgcccatactcagaacaagttccaagtattaaaattccaatggacatcatggaa
caacaacctttcctaagtgatagcaaaccttctgacagagaaagatcaccaacattcctt
gaacgccacacatcgtgctga

DBGET integrated database retrieval system