KEGG   Rousettus aegyptiacus (Egyptian rousette): 107504052
Entry
107504052         CDS       T06036                                 

Gene name
BRAF
Definition
(RefSeq) serine/threonine-protein kinase B-raf isoform X1
  KO
K04365  B-Raf proto-oncogene serine/threonine-protein kinase [EC:2.7.11.1]
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray01521  EGFR tyrosine kinase inhibitor resistance
ray01522  Endocrine resistance
ray04010  MAPK signaling pathway
ray04012  ErbB signaling pathway
ray04015  Rap1 signaling pathway
ray04024  cAMP signaling pathway
ray04062  Chemokine signaling pathway
ray04068  FoxO signaling pathway
ray04150  mTOR signaling pathway
ray04270  Vascular smooth muscle contraction
ray04510  Focal adhesion
ray04650  Natural killer cell mediated cytotoxicity
ray04720  Long-term potentiation
ray04722  Neurotrophin signaling pathway
ray04726  Serotonergic synapse
ray04730  Long-term depression
ray04810  Regulation of actin cytoskeleton
ray04910  Insulin signaling pathway
ray04914  Progesterone-mediated oocyte maturation
ray04928  Parathyroid hormone synthesis, secretion and action
ray04934  Cushing syndrome
ray05010  Alzheimer disease
ray05022  Pathways of neurodegeneration - multiple diseases
ray05034  Alcoholism
ray05160  Hepatitis C
ray05161  Hepatitis B
ray05200  Pathways in cancer
ray05205  Proteoglycans in cancer
ray05210  Colorectal cancer
ray05211  Renal cell carcinoma
ray05212  Pancreatic cancer
ray05213  Endometrial cancer
ray05214  Glioma
ray05215  Prostate cancer
ray05216  Thyroid cancer
ray05218  Melanoma
ray05219  Bladder cancer
ray05220  Chronic myeloid leukemia
ray05221  Acute myeloid leukemia
ray05223  Non-small cell lung cancer
ray05224  Breast cancer
ray05225  Hepatocellular carcinoma
ray05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107504052 (BRAF)
   04012 ErbB signaling pathway
    107504052 (BRAF)
   04015 Rap1 signaling pathway
    107504052 (BRAF)
   04068 FoxO signaling pathway
    107504052 (BRAF)
   04024 cAMP signaling pathway
    107504052 (BRAF)
   04150 mTOR signaling pathway
    107504052 (BRAF)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107504052 (BRAF)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107504052 (BRAF)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    107504052 (BRAF)
   04062 Chemokine signaling pathway
    107504052 (BRAF)
  09152 Endocrine system
   04910 Insulin signaling pathway
    107504052 (BRAF)
   04914 Progesterone-mediated oocyte maturation
    107504052 (BRAF)
   04928 Parathyroid hormone synthesis, secretion and action
    107504052 (BRAF)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    107504052 (BRAF)
  09156 Nervous system
   04726 Serotonergic synapse
    107504052 (BRAF)
   04720 Long-term potentiation
    107504052 (BRAF)
   04730 Long-term depression
    107504052 (BRAF)
   04722 Neurotrophin signaling pathway
    107504052 (BRAF)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107504052 (BRAF)
   05205 Proteoglycans in cancer
    107504052 (BRAF)
  09162 Cancer: specific types
   05210 Colorectal cancer
    107504052 (BRAF)
   05212 Pancreatic cancer
    107504052 (BRAF)
   05225 Hepatocellular carcinoma
    107504052 (BRAF)
   05226 Gastric cancer
    107504052 (BRAF)
   05214 Glioma
    107504052 (BRAF)
   05216 Thyroid cancer
    107504052 (BRAF)
   05221 Acute myeloid leukemia
    107504052 (BRAF)
   05220 Chronic myeloid leukemia
    107504052 (BRAF)
   05218 Melanoma
    107504052 (BRAF)
   05211 Renal cell carcinoma
    107504052 (BRAF)
   05219 Bladder cancer
    107504052 (BRAF)
   05215 Prostate cancer
    107504052 (BRAF)
   05213 Endometrial cancer
    107504052 (BRAF)
   05224 Breast cancer
    107504052 (BRAF)
   05223 Non-small cell lung cancer
    107504052 (BRAF)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    107504052 (BRAF)
   05022 Pathways of neurodegeneration - multiple diseases
    107504052 (BRAF)
  09165 Substance dependence
   05034 Alcoholism
    107504052 (BRAF)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    107504052 (BRAF)
  09172 Infectious disease: viral
   05161 Hepatitis B
    107504052 (BRAF)
   05160 Hepatitis C
    107504052 (BRAF)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    107504052 (BRAF)
   01522 Endocrine resistance
    107504052 (BRAF)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ray01001]
    107504052 (BRAF)
Enzymes [BR:ray01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     107504052 (BRAF)
Protein kinases [BR:ray01001]
 Serine/threonine kinases: TKL group
  RAF family [OT]
   107504052 (BRAF)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase RBD C1_1 Kinase-like zf-RING-like C1_2 Pkinase_fungal APH Kdo
Other DBs
NCBI-GeneID: 107504052
NCBI-ProteinID: XP_015988484
LinkDB
Position
Unknown
AA seq 805 aa
MAALSGGGDAEQGQALFNGDMEPEAGAGAAASSAADPAIPEEVWNIKQMIKLTQEHIEAL
LDKFGGEHNPPSIYLEAYEEYTSKLDALQQREQQLLESLGNGTDFSVSSSASTDTVTSSS
SSSLSVLPSSLSVFQNPTDVSRSNPKSPQKPIVRVFLPNKQRTVVPARCGVTVRDSLKKA
LMMRGLIPECCAVYRIQDGEKKPIGWDTDISWLTGEELIVEVLENVPLTTHNFVRKTFFT
LAFCDFCRKLLFQGFRCQTCGYKFHQRCSTEVPLMCVNYDQLDLLFVSKFFEHHPIPQEE
ASLTETTLTSGSSPSAPPSDSTGPQILTSPSPSKSIPIPQPFRPADEDHRNQFGQRDRSS
SAPNVHINTIEPVNIDEKFPEVELQDQRDLIRDQGFRSDGAPLNQLMRCLRKYQSRTPSP
LLHSVPSEIVFDFEPGPVFRGSTTGLSATPPASLPGSLTNVKALQKSPGPQRERKSSSSS
EDRNRMKTLGRRDSSDDWEIPDGQITVGQRIGSGSFGTVYKGKWHGDVAVKMLNVTAPTP
QQLQAFKNEVGVLRKTRHVNILLFMGYSTKPQLAIVTQWCEGSSLYHHLHIIETKFEMIK
LIDIARQTAQGMDYLHAKSIIHRDLKSNNIFLHEDLTVKIGDFGLATVKSRWSGSHQFEQ
LSGSILWMAPEVIRMQDKNPYSFQSDVYAFGIVLYELMTGQLPYSNINNRDQIIFMVGRG
YLSPDLSKVRSNCPKAMKRLMAECLKKKRDERPLFPQENLQPSSSHIIMAASTLISLSLV
FIQFVNIKTQFCSSNLFLKIQISNA
NT seq 2418 nt   +upstreamnt  +downstreamnt
atggcggcgctgagcggcggcggcgacgcggagcagggccaggctctgttcaacggggac
atggagcccgaggctggcgccggcgccgcggcctcttcggctgcggaccccgccatcccc
gaggaggtgtggaatatcaaacagatgataaagttgacacaggaacatatagaggcccta
ttggacaaatttggtggggagcataatccaccgtcaatatatctagaggcctatgaagaa
tacaccagcaagctagatgccctccaacaaagagaacaacagttattggaatccctgggg
aatggaactgatttttctgtttctagctctgcatcaacggacaccgttacatcctcttcc
tcttctagcctttcagtgctaccttcatctctttcagtttttcaaaatcccacagatgtg
tcacggagcaaccctaaatcaccacaaaaacctattgttagagtcttcctgcccaacaaa
cagaggacagtggtacctgcacggtgtggagttacagtccgggacagtctaaagaaagct
ctgatgatgagaggtctaatcccagagtgctgcgccgtttacagaattcaagatggagag
aagaagccaattggctgggacaccgatatttcctggcttactggagaggagttaattgta
gaagtgctggagaatgttccacttacaacacacaactttgtacggaaaacttttttcacc
ttagcattttgtgacttttgtcgaaagctgcttttccagggtttccgctgtcaaacatgt
ggttataaatttcaccagcgttgtagtacagaggttcctctgatgtgtgttaattatgac
caacttgatttgctgtttgtctccaagttctttgaacaccacccaataccacaggaggag
gcctccctaacagagaccacccttacgtctggatcatccccttccgcacccccttccgat
tctactgggccccaaattctcaccagtccgtctccttcaaaatccattccaattccacag
cctttccgaccagcagatgaagatcatcgaaatcagtttggacaacgagaccggtcctcg
tcagctccaaatgtgcatataaacacaatagagcctgtcaatattgatgaaaaattccca
gaagtggaattacaggatcaaagggacttgattagagaccaagggtttcgtagtgatgga
gcccctttgaaccagctgatgcgctgtcttcggaaataccaatcccggactcccagtccc
ctcctacattctgtccccagtgaaatagtgtttgattttgagcctggcccagtgttcaga
ggatcaaccacaggtttgtctgccacgccccctgcctcattgcctggctcactcactaat
gtgaaagcattgcagaaatctccaggacctcagcgggaaaggaaatcatcatcttcctca
gaagacaggaatcgaatgaaaacacttggtagacgggattcaagtgacgattgggagatt
cctgatgggcagatcacagtgggacaaagaattggatccgggtcatttgggacagtctac
aagggaaagtggcatggtgatgtggcagtgaagatgttgaatgtgacggcacccacacct
cagcagttacaggccttcaaaaatgaagtgggagtactcaggaaaacgcgacatgtgaat
atcctactcttcatgggctattcaacaaagccacaactggctattgttacccagtggtgt
gagggctccagcttatatcaccatctccacatcattgagaccaaatttgagatgatcaaa
cttatagatattgcacggcagactgcacagggcatggattacttacacgccaagtcaatc
atccacagagacctcaagagtaataatatatttcttcatgaagacctcacagtaaaaata
ggtgactttggtctagccacagtgaaatctcgatggagtgggtcccatcagtttgaacag
ttgtctggatccattttgtggatggcaccagaagtaatcagaatgcaagataaaaaccca
tatagttttcagtcagatgtatatgcatttgggattgttttgtatgaattgatgactgga
cagttaccttattcaaacatcaacaacagggaccagataatttttatggtgggacgagga
tatctgtctccagatctcagtaaggtacgaagtaactgtccaaaagccatgaagagatta
atggcagagtgcctaaaaaagaaaagagatgagagaccactctttccccaagagaatttg
cagccttcaagtagccacatcatcatggcagcatctactcttatttctttaagtcttgtg
ttcatacaatttgttaacatcaaaacacagttctgttcctcaaatctttttttaaagata
caaatttccaatgcataa

DBGET integrated database retrieval system