KEGG   Rousettus aegyptiacus (Egyptian rousette): 107504088Help
Entry
107504088         CDS       T06036                                 

Gene name
HK1
Definition
(RefSeq) hexokinase-1 isoform X1
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray00010  Glycolysis / Gluconeogenesis
ray00051  Fructose and mannose metabolism
ray00052  Galactose metabolism
ray00500  Starch and sucrose metabolism
ray00520  Amino sugar and nucleotide sugar metabolism
ray00524  Neomycin, kanamycin and gentamicin biosynthesis
ray01100  Metabolic pathways
ray01200  Carbon metabolism
ray04066  HIF-1 signaling pathway
ray04910  Insulin signaling pathway
ray04930  Type II diabetes mellitus
ray04973  Carbohydrate digestion and absorption
ray05230  Central carbon metabolism in cancer
Module
ray_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
ray_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ray00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    107504088 (HK1)
   00051 Fructose and mannose metabolism
    107504088 (HK1)
   00052 Galactose metabolism
    107504088 (HK1)
   00500 Starch and sucrose metabolism
    107504088 (HK1)
   00520 Amino sugar and nucleotide sugar metabolism
    107504088 (HK1)
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    107504088 (HK1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    107504088 (HK1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    107504088 (HK1)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    107504088 (HK1)
 09160 Human Diseases
  09161 Cancer: overview
   05230 Central carbon metabolism in cancer
    107504088 (HK1)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    107504088 (HK1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ray04131]
    107504088 (HK1)
Enzymes [BR:ray01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     107504088 (HK1)
Membrane trafficking [BR:ray04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    107504088 (HK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1 CSD
Motif
Other DBs
NCBI-GeneID: 107504088
NCBI-ProteinID: XP_015988563
LinkDB All DBs
Position
Unknown
AA seq 917 aa AA seqDB search
MIAAQLLAYYFTELKDDQVKKIDKYLYTMRLSDETLIDIMTRFKREMKNGLSRDFNATAT
VKMLPTFVRSIPDGSEKGDFIALDLGGSSFRILRVQVNLEKNKNVHMESETYETAEEIMH
GSGSQLFDHVAECLGDFMEKRKIKDKKLPVGLTFSFPCQQSKIDEGILITWTKRFKVSGV
EGVDVVKLLNKAIKKRGDYDANVVAVVNDTVGTMMTCGYDDQQCEVGLIIGTGTNACYME
ELRHIDLVEGDEGRMCINTEWGAFGDDGSLEDIRTEFDREIDRGSLNPGKQLFEKMISGM
YLGELVRLILVKMAKEGLLFEGRITPELLTRGKFNTSDVSAIEKNKEGLQNAKEILTRLG
VEPSDDDCVSVQHVCTIVSFRSANLVAATLATILNRLRDNKGSPRLRTTVGVDGSLYKTH
PQYSRRFHKTLRRLVPDSDVRFLLSESGSGKGAAMVTAVAYRLAEQHRQIEETLAHFCLT
KEMLLEVKKRMRIEMEMGLKKKTHDKAVVKMLPSFVRSIPDGTEHGDFLALDLGGTNFRV
LLVKMRSGKKRTVEMHNKIYAIPIEIMQGTGEELFDHIVSCISDFLDYMGIKGPRMPLGF
TFSFPCKQTSLDEGILITWTKGFKATDCVGHDVATLLRDAIKRREEFDLDVVAVVNDTVG
TMMTCAYEEPTCEVGLIVGTGSNACYMEEMKNVEMLEGNEGQMCINMEWGAFGDNGCLDD
IRTNYDRVVDEYSLNAGKQRYEKMISGMYLGEIVRNILIDFTKKGFLFRGQISEPLKTRG
IFQTKYLSQIESDRLALLQVRSILQQLGLNSTCDDSILVKTVCGVVSKRAAQLCGAGMAA
VVDKIRENRGLDHLNVTVGVDGTLYKLHPHFSRIMHQTVKELSPKCNVSFLLSEDGSGKG
AALITAVGVRLREGTSS
NT seq 2754 nt NT seq  +upstreamnt  +downstreamnt
atgatcgccgcgcagctcctggcctattacttcaccgagctgaaggatgaccaagtcaaa
aagattgacaagtatctctataccatgcggctctccgatgaaactctgatagatatcatg
actcgtttcaagagggaaatgaagaatggtctttcccgggattttaatgcaacagctaca
gtcaagatgttgccaacgtttgtaaggtccattcctgatggttcagaaaagggagatttc
attgcactggatcttggtgggtcttcctttcgaattctgcgagttcaagtgaatctggag
aaaaacaagaatgttcacatggaatctgagacttatgagactgcggaggagatcatgcat
ggcagtggaagccagctttttgatcatgttgctgagtgcctgggagatttcatggaaaaa
agaaaaatcaaggacaagaaattacctgtggggctcacattctcttttccttgtcagcaa
tccaaaattgacgagggtatcctgatcacctggacaaagcgatttaaagtgagcggagtg
gagggagtagatgtggtgaagctgcttaacaaagccatcaaaaaacgaggggattatgat
gccaacgttgtggctgtggtgaatgacacagtggggaccatgatgacctgtggctatgat
gaccagcagtgtgaagttggcctcatcattggcactggcactaatgcttgctacatggag
gagctgaggcacattgacctggtagaaggcgacgaggggaggatgtgcattaacaccgag
tggggggcctttggggatgacgggtccctggaagacatccgcaccgagtttgaccgtgag
atagaccgaggatctctcaaccctggaaaacagctgtttgaaaagatgatcagtggcatg
tacctgggagagctggttcgactgatcctggtcaagatggccaaggagggccttttattt
gaagggcggatcaccccagagctgctcaccagagggaagtttaacaccagtgatgtgtca
gccattgaaaagaataaggaaggcctccaaaatgccaaagaaatcctgacccgcctggga
gtggagccgtccgatgacgactgcgtttcggtccagcacgtgtgcaccattgtctcattc
cgctctgccaacctggtggctgcgacgctggccaccatcttgaatcgccttcgcgataac
aagggctctcccaggctgcggaccacggttggtgtcgacgggtctctttacaagacgcac
ccacagtattcccggcgtttccataagacgctgaggcgcttggtgcctgactccgacgtg
cgtttcctcctttcggagagtggcagtggcaagggggccgccatggtgactgcagtggcc
taccgcctggccgagcagcaccggcagatagaggagaccctggcccacttctgcctcacc
aaggaaatgctgctggaggtgaagaagaggatgcggattgagatggaaatggggctaaag
aagaagacacacgataaggccgtagtcaagatgctgccctccttcgtccggagtattcca
gatgggactgaacatggtgacttcttggccctggatcttggaggaacaaatttccgcgtc
ctgctggtaaaaatgcgtagtgggaaaaagagaaccgttgaaatgcacaacaagatctat
gccattcccattgaaatcatgcagggcactggggaagagctgtttgaccacatcgtctcc
tgcatctccgacttcctggactacatggggatcaaaggccccagaatgcctctgggcttc
acgttctcgtttccctgcaagcagacgagcttggatgagggaatcttgattacctggacc
aaggggtttaaggccaccgactgcgtggggcacgatgtagccaccttgctaagggatgcg
atcaaaaggagagaggaatttgatctggatgtggtggctgtagtcaacgacacggtgggc
accatgatgacctgcgcttatgaggagcccacctgtgaggttggactcattgtagggacc
ggcagcaatgcctgctacatggaagaaatgaagaatgtggagatgctggaggggaacgag
ggacaaatgtgtatcaatatggagtggggtgcctttggggacaacgggtgtctggatgat
atcagaacaaactatgacagagtggtggatgaatattctctaaatgctgggaaacaaagg
tatgagaagatgataagtggcatgtacctgggtgaaatcgtccgcaacatcctgatcgac
ttcaccaagaagggattccttttccgagggcagatctctgagccactgaagactcggggc
atctttcagaccaagtatctctctcagatcgagagtgaccgattagcgctgctccaggtc
cgaagcatcctccagcagctgggcctgaatagcacctgtgatgacagtatcctcgtcaag
accgtgtgcggggtggtgtccaagagggccgcacagctgtgtggcgcaggcatggctgcc
gtggtggataagatccgagagaacagggggctggaccatctcaacgtgactgtgggggtg
gatggaacactctacaagcttcacccacacttctccagaatcatgcaccaaaccgtgaag
gaactgtcaccaaaatgtaatgtgtccttcctcctgtcggaagatggtagtggcaagggg
gctgccctcatcacggcagtgggcgttcggctccgagaaggaacgagcagctaa

DBGET integrated database retrieval system