KEGG   Rousettus aegyptiacus (Egyptian rousette): 107504398
Entry
107504398         CDS       T06036                                 

Definition
(RefSeq) pancreatic alpha-amylase
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray00500  Starch and sucrose metabolism
ray01100  Metabolic pathways
ray04970  Salivary secretion
ray04972  Pancreatic secretion
ray04973  Carbohydrate digestion and absorption
Brite
KEGG Orthology (KO) [BR:ray00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    107504398
 09150 Organismal Systems
  09154 Digestive system
   04970 Salivary secretion
    107504398
   04972 Pancreatic secretion
    107504398
   04973 Carbohydrate digestion and absorption
    107504398
Enzymes [BR:ray01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     107504398
SSDB
Motif
Pfam: Alpha-amylase Alpha-amylase_C
Other DBs
NCBI-GeneID: 107504398
NCBI-ProteinID: XP_015989042
LinkDB
Position
Unknown
AA seq 511 aa
MKYFLLLATIGLCWAQYAPNTKPGQTSIVHLFEWRWVDIALECERYLAPKGFGGVQISPP
NENVVINNPSRPWWERYQPISYKLCTRSGNEDEFKDMVTRCNNVGVHIYVDAVINHMCGN
AVGAGTSSTCGSYFNPGNRDFPAVPFSGWDFNDGKCKTKNGDIENYNDPYQVRDCRLVGL
LDLALEKDYVRSKIAEYLNHLIDIGVAGFRIDASKHMWPGDMKAILEKLHNLNTTWFPEG
SKPFIYQEVIDLGSEPIKSSEYFENGRVTEFKYGAKLGTVLRKWNGEKMAYLKNWGEGWG
FMPSDRALVFVDNHDNQRGHGAGGASILTFWDPRLYKMGVGFMLAHPYGFTRVMSSFHWP
RYFENGKDVNDWVGPPNNNGVIKEVTINPDTTCGNDWVCEHRWRQIRNMVMFRNVVDGQP
FTNWWDNGSNQVAFGRGNRGFIVFNNDDWPLSLTLQTGLPTGTYCDVISGDKIGDNCTGI
KIYVSGDGNAHFSISNSAEDPFVAIHAESKL
NT seq 1536 nt   +upstreamnt  +downstreamnt
atgaagtactttctattgcttgcaaccattgggctctgctgggctcagtatgccccaaat
accaaacctggacaaacatctattgttcatctgtttgagtggcgctgggttgatattgct
cttgaatgtgagcgatacttagctcccaaaggatttggaggggttcagatctccccaccc
aatgaaaatgttgtaattaacaacccttcgagaccttggtgggaaagataccaaccaatt
agctacaagttatgtacaagatctggaaatgaagatgaattcaaagacatggtgactaga
tgtaacaacgttggtgttcatatttatgtggatgctgtaattaatcatatgtgtggaaat
gctgtgggcgcagggaccagtagtacttgtggaagttacttcaatcctggaaatagagat
tttccagcagtccctttctctggttgggattttaatgatggtaaatgtaaaactaaaaat
ggagatattgagaactacaatgatccttatcaggtcagagattgtcgtctagttggccta
cttgatcttgcactggagaaagattatgttcgttccaagattgctgaatatctgaaccat
ctcatcgacattggtgtagcaggattcagaattgatgcttctaagcacatgtggcctgga
gacatgaaggcaattttggaaaaactgcataatctaaacacaacctggttccctgaagga
agtaaacctttcatttaccaggaggtaattgatttgggtagtgagccaattaaaagcagt
gagtactttgaaaatggccgtgtgacagaatttaagtatggtgcaaaactaggcacagtt
ctgcgcaaatggaatggagagaagatggcttacttaaaaaactggggagaaggctggggt
ttcatgccttctgatagagctcttgtctttgtggataaccatgacaatcagagaggacat
ggagctggaggagcatctattcttacattctgggatcctagactgtacaaaatgggagtt
ggatttatgcttgctcatccttatggatttacacgagtaatgtcaagcttccattggcca
agatattttgaaaatggaaaagatgttaatgattgggttggaccaccaaataataatgga
gtaattaaagaagttactattaatccggacactacttgtggcaatgactgggtctgtgaa
catcgatggcgtcaaataagaaacatggttatgttccgtaatgtagttgatggccaacct
tttacaaactggtgggataatggtagcaatcaagtagcttttggaagaggaaacagagga
ttcattgtctttaacaatgatgactggccactgtctttaactttgcaaactggtcttcct
actggcacatattgtgatgttatttctggagataaaattggtgacaattgtacaggaatt
aaaatctatgtttctggtgatggaaatgctcatttctctattagtaactctgctgaagat
ccatttgttgcaattcatgctgaatctaaactgtaa

DBGET integrated database retrieval system