KEGG   Rousettus aegyptiacus (Egyptian rousette): 107504408
Entry
107504408         CDS       T06036                                 

Gene name
PTK2
Definition
(RefSeq) focal adhesion kinase 1 isoform X1
  KO
K05725  focal adhesion kinase 1 [EC:2.7.10.2]
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray01522  Endocrine resistance
ray04012  ErbB signaling pathway
ray04062  Chemokine signaling pathway
ray04151  PI3K-Akt signaling pathway
ray04360  Axon guidance
ray04370  VEGF signaling pathway
ray04510  Focal adhesion
ray04670  Leukocyte transendothelial migration
ray04810  Regulation of actin cytoskeleton
ray04935  Growth hormone synthesis, secretion and action
ray05100  Bacterial invasion of epithelial cells
ray05135  Yersinia infection
ray05146  Amoebiasis
ray05163  Human cytomegalovirus infection
ray05165  Human papillomavirus infection
ray05170  Human immunodeficiency virus 1 infection
ray05200  Pathways in cancer
ray05202  Transcriptional misregulation in cancer
ray05205  Proteoglycans in cancer
ray05222  Small cell lung cancer
ray05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    107504408 (PTK2)
   04370 VEGF signaling pathway
    107504408 (PTK2)
   04151 PI3K-Akt signaling pathway
    107504408 (PTK2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107504408 (PTK2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107504408 (PTK2)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    107504408 (PTK2)
   04062 Chemokine signaling pathway
    107504408 (PTK2)
  09152 Endocrine system
   04935 Growth hormone synthesis, secretion and action
    107504408 (PTK2)
  09158 Development and regeneration
   04360 Axon guidance
    107504408 (PTK2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107504408 (PTK2)
   05202 Transcriptional misregulation in cancer
    107504408 (PTK2)
   05205 Proteoglycans in cancer
    107504408 (PTK2)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    107504408 (PTK2)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    107504408 (PTK2)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    107504408 (PTK2)
   05100 Bacterial invasion of epithelial cells
    107504408 (PTK2)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    107504408 (PTK2)
   05163 Human cytomegalovirus infection
    107504408 (PTK2)
   05165 Human papillomavirus infection
    107504408 (PTK2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    107504408 (PTK2)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    107504408 (PTK2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ray01001]
    107504408 (PTK2)
   01009 Protein phosphatases and associated proteins [BR:ray01009]
    107504408 (PTK2)
Enzymes [BR:ray01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     107504408 (PTK2)
Protein kinases [BR:ray01001]
 Non-receptor tyrosine kinases
  FAK family
   107504408 (PTK2)
Protein phosphatases and associated proteins [BR:ray01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     107504408 (PTK2)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Focal_AT Pkinase FERM_N_2 FERM_M Kinase-like FERM_F2
Other DBs
NCBI-GeneID: 107504408
NCBI-ProteinID: XP_015989055
LinkDB
Position
Unknown
AA seq 1142 aa
MCLELAGQEAPRAAGAARMERSGCSPFPLCWAEEYDRYLASSKIMAAAYLDPNLNHTPNS
SAKTHLGTGVERSPGAMERVLKVFHYFESNSEPATWASIIRHGDATDVRGIIQKIVDSHK
VKHVACYGFRLSHLRSEEVHWLHLDMGVSNVREKYELAHPPEEWKYELRIRYLPKGFLNQ
FTEDKPTLNFFYQQVKSDYMLEIADQVDQDIALKLGCLEIRRSYWEMRGNALEKKSNYEV
LEKDVGLKRFFPRSLLDSVKAKTLRKLIQQTFRQFANLNREESILKFFEILSPVYRFDKE
CFKCALGSSWIISVELAIGPEEGISYLTDKGCSPTHLADFNQVQTIQYSNSDDKDRKGML
QLKVAGAPEPLTVTAPSLTIAENMADLIDGYCRLVNGATQSFIIRPQKEGERALPSIPKL
ANSDKQGVRTHAVSVSGVSHCQHKVKKARRFLPLVFCALDPPPADEISGDETDDYAEIID
EEDTYTMPSKSYGIDEARDYEIQRERIELGRCIGEGQFGDVHQGVYMSPENPALAVAIKT
CKNCTSDSVREKFLQEALTMRQFDHPHIVKLIGVITENPVWIIMELCTLGELRSFLQVRK
HSLGLASLVLYAYQLGTALAYLESKRFVHRDIAARNVLVSSNDCVKLGDFGLSRYMEDST
YYKASKGKLPIKWMAPESINFRRFTSASDVWMFGVCMWEILMHGVKPFQGVKNNDVIGRI
ENGERLPMPPNCPPTLYSLMTKCWAYDPSRRPRFTELKAQLSTILEEEKAQQEERMRMES
RRQVAVSWDSGGPDEAPPKPSRPGYPSPRSSEGFYPSPQHMVQTNHYQVSGYSGPHGVTA
MASSIYPGQASFLEQVDPWSHRPKETATWTPAAEDSAVLDLRGLGQVLPPPPHLMEERLI
RQQQEMEEDQRWLEKEERFLKPDVRLSRGSIDREDGGLQGLTGNQHIYQPVGKPDPAAPP
KKPPRPGAPGHLGSLASLSSPGDSYNEGVKPWRLQPQEISPPPTANLDRSSDRVYEHVTG
LVKAVIEMSSKIQPAPPEEYVPMVKEVGLALRTLLATVDETIPVLPASTHREIEMAQKLL
NSDLGEVISKTKLAQQCVVTSLQQEYKKQVLTAAHALAVDAKNLLDVIDQARLKPRGQTR
PH
NT seq 3429 nt   +upstreamnt  +downstreamnt
atgtgcttggaactggcgggccaggaggccccgagggcggcaggggccgcccgcatggag
aggagcggctgcagcccgttcccgctgtgctgggccgaagaatatgacaggtacctagca
tctagcaaaataatggcagctgcttacctcgacccgaacttgaatcacacaccgaattcg
agtgccaagactcacctggggacaggtgtggaacgttcccccggagcgatggagcgcgtg
ctcaaggtctttcattattttgagagcaacagtgagccagccacctgggccagtatcatc
aggcatggggacgccaccgacgtcaggggcatcattcagaagatagtggacagtcacaaa
gtaaagcacgtggcctgctatggatttcgcctcagtcacctgcggtccgaggaggttcac
tggctccatttggatatgggtgtctccaatgtgagggagaagtatgaacttgcacaccca
ccagaggagtggaaatatgaattgagaattcgttatttgccaaaaggatttctaaaccag
tttactgaagacaagccaactttgaatttcttctatcaacaggtgaagagcgattacatg
ctagagatagccgaccaggtggaccaggacatcgccctgaagctgggctgtctggagata
cggcgatcgtactgggagatgcggggcaatgcgctggagaagaagtccaactatgaagtt
ttagaaaaggatgtcggtttgaagcgatttttccccaggagtttgctggattccgtcaag
gccaaaacactaagaaaactcatccagcagacgttcagacagttcgccaacctgaacaga
gaagaaagcattctgaagttcttcgagatcctgtccccggtgtacagattcgataaggaa
tgcttcaagtgcgccctcggttcgagctggatcatttcggtggagctggcgatcggccca
gaggaaggcatcagctacctcacggacaagggctgcagccccacacacctggccgacttc
aatcaagtgcagaccatccagtattcaaacagcgacgacaaggacaggaaaggaatgctc
cagctgaaagtcgcaggcgcgcccgagcctctgacggtgacagccccgtccctgaccatc
gccgagaacatggccgacttgatagatgggtattgccggctggtgaacggagccacgcag
tctttcatcatcagaccccagaaagaaggcgaacgggctttgccatcaataccaaagctg
gccaacagcgacaagcagggcgtgcggacacacgcggtctccgtgtcaggagtcagtcac
tgccagcataaagttaagaaagccaggcgctttctccctttggtcttctgtgccctcgac
cctccccccgcggatgaaattagtggggacgaaacagacgattatgcggagattatagac
gaagaagatacttacaccatgccctcaaaaagctatggaatagatgaagccagggactat
gagattcagagagagaggatagagctggggcgatgcattggagaaggccagttcggagac
gtgcaccagggcgtgtacatgagcccggagaatccggctttggcggttgcaattaaaaca
tgtaaaaactgtacctcggacagcgtgagagagaaattccttcaagaagccttaacgatg
cgtcagtttgaccaccctcacatcgtgaagctgatcggcgtcatcacggagaaccccgtc
tggatcatcatggagctgtgcacactcggagagctgcggtcgttcctgcaggtcaggaaa
cacagcctgggcctggcgtcgctggtgctgtacgcctaccagctgggcacggccctcgcc
tacctggaaagcaaaagattcgtgcacagggacattgctgctcggaatgttctggtgtcc
tcaaatgattgtgtaaaattaggagactttggattgtcccgctatatggaagacagtacc
tactacaaagcttccaaaggaaaattgcctattaaatggatggctccagagtcaatcaat
tttcgacgttttacctcagctagcgatgtgtggatgtttggcgtgtgcatgtgggagatc
ctgatgcacggcgtgaagcctttccagggcgtgaagaacaacgacgtgatcggccggatc
gagaacggcgagcgcctcccgatgcctccgaactgcccccccacgctctacagcctcatg
acgaagtgctgggcctacgaccccagccggcggccccggttcaccgagctcaaagcccag
ctcagcacgatcctggaggaggagaaggcccagcaggaggagcgcatgcggatggagtcc
cgaagacaggtcgcggtgtcctgggactccggagggcccgacgaggcaccgcccaagccc
agcagacccggttatcctagtccaaggtccagcgaaggattttaccccagcccgcagcac
atggtacagaccaaccattaccaggtctctggctactctggtccacacggggtgacagcc
atggccagcagcatctacccgggacaggcctctttcctggagcaggtggacccgtggagt
cacaggccgaaggagacggcgacgtggacgcctgctgcggaggactctgccgtgctggac
ctgcggggcctcggccaggtgctgccgccgccgccgcacctgatggaggagcggctgatc
cggcagcagcaggagatggaggaggaccagcgctggctggagaaggaggagcggtttctg
aagcctgacgtgcggctctcgcgaggcagcatcgacagggaggacggagggctccagggc
ctgaccggaaaccagcacatctaccagcccgtggggaagccagatcctgcggctccgcca
aagaagccaccacgccctggcgcccccggccacctgggcagcctcgccagcctcagcagc
cctggggacagttacaacgagggcgtcaagccgtggaggcttcagccccaggaaatcagc
ccccctcccaccgccaacctggaccgctccagcgacagggtgtacgagcatgtgacgggc
ctggtgaaggccgtcatcgagatgtccagcaagatccagccggccccgccggaggagtac
gtgcccatggtgaaggaggtcggcctggccctgcggacgctgctggccacggtggatgag
accattcccgtcctgccggccagcacccaccgagagatcgagatggcccagaagctgctg
aactccgacctgggggaggtcatcagcaagacgaagctggcccagcagtgcgtcgtgacc
agcctccagcaggagtacaagaagcaggtgctgaccgccgcccacgcgctggccgtagac
gccaagaacctgctggacgtcatcgaccaggcccggctgaagccgcgcggccagacgagg
ccgcactga

DBGET integrated database retrieval system