KEGG   Rousettus aegyptiacus (Egyptian rousette): 107504507
Entry
107504507         CDS       T06036                                 

Gene name
ABCC3
Definition
(RefSeq) canalicular multispecific organic anion transporter 2 isoform X1
  KO
K05667  ATP-binding cassette, subfamily C (CFTR/MRP), member 3
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray01523  Antifolate resistance
ray02010  ABC transporters
ray04976  Bile secretion
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    107504507 (ABCC3)
 09150 Organismal Systems
  09154 Digestive system
   04976 Bile secretion
    107504507 (ABCC3)
 09160 Human Diseases
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    107504507 (ABCC3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ray02000]
    107504507 (ABCC3)
Transporters [BR:ray02000]
 ABC transporters, eukaryotic type
  ABCC (CFTR/MRP) subfamily
   ABCC1, 2, 3, 4, 5, 6, 10, 11, 12, 13 subgroups
    107504507 (ABCC3)
SSDB
Motif
Pfam: ABC_membrane ABC_tran SMC_N AAA_16 MMR_HSR1 RsgA_GTPase AAA_25 AAA_29 AAA_21 ABC_ATPase Dynamin_N RNA_helicase dNK AAA_PrkA YadA_anchor
Other DBs
NCBI-GeneID: 107504507
NCBI-ProteinID: XP_015989240
LinkDB
Position
Unknown
AA seq 1529 aa
MDALCGSGELGSKFWDSNLSVYTDNPDLTPCFQNSLLAWVPCIYLWATLPFYLLYLWHHH
RGYITLSRLSKLKTVLGVLLWCISWADLFYSFHGLIHGWAPAPIFFVTPLVVGVTMLVAT
LLIQYERLQGVQSSGVLIIFWFLCVVCAIIPFRSKILSTVAKGKILDPFRFATFYIYFAL
VLCALILSCFKEKPPFFSSRNVDPNPCPEANAGFLSFLTFWWFTKMAILGYRRPLKEQDL
WSLNKEDHSEIVVKSLLDAWKKQQKRAARDKGKAAPGKTVSTEDEELLGDRPGPREPSFL
RALLAVFGPSFLIGMCFLLLHDLLSFVNPQLLSMLIRFISNPTAPVWWGFLLAGMMFVCS
MMQTLISHQYFHRIFTMGLRLRTGIMGVVYGKALVITNSVKRKFTLGEMVNLISVDAQRF
MDLVFLLNLLWSAPLQIILAVYFLWQKLGPSILAGVTLMVLLIPVNGGVAMKMRAFQVEQ
MKLKDSRIKLMSEILGGIKVLKLYAWEPSFLQEVERIRQSELRLLRKGAYLHAVSTFIWM
CTPFLVTLITLTVYVSVDPNNVLDAEKAFVSVSLFNILKNPLSLLPVLISNLTQTSVSLK
RIQNFLNQDEFDPQCVERKTITPGYAVTIDNGTFTWAQDRPPTLHSLDIQVPKGTLVAVV
GPVGCGKSSLLSALLGEMEKLEGKVYVKGSVAYVPQQAWIQNCTLQENVLFGQALDPKRY
NQTLEACALLADLEVLSGGDQTEIGEKGINLSGGQQQRVSLARAVYSNADIFLLDDPLSA
VDSHVAKHIFDHVIGPEGVLASKTRVLVTHGISFLPQTDFVVVLDDGQVSEVGTYSALLQ
RNGSFASFLHNYAPDEDKKYQEEDVRTAFEDPDDEQVLLIEDTLSSHADLMDNEPVMYEV
RKQFMRELSTMSLEGEGHSRPVHQRRLSTAEKVVQAAEVKAKGALIEEEKVEMGRVKLNM
FWDYAKAMGLCTTLVICLLYAGQSAAAVGANMWLSAWTNEAAVGGQQNNTSMRLGVYAAF
GLLQGLLVVLSAFAMAVGSVQAAHSLHRALLHNMMRSPQSFFDTTPSGRILNRFSKDIYV
IDEVLGPSILMLLGCFYNSIGILVVIVVNTPLFVVVFLPLAVLYLFVQRFYVATSQQLKR
LESVSRSPIFSHFSETVTGSSVIRASGRSKDFEAISNAKVDTNLKSCYPNIASNRWLGIR
VEFMGNCVVLFVALFAVVGRSSLSPGLVGLSVSYALQVTFALNWMIRMMSELESNIVAVE
RVKEYSKTETEAPWVVEGSRPPADWPSGGEVEFRNFSARYRPGLELVLKNLSLRVRSGEK
VGIVGRTGAGKSSMTLCLFRILEAAEGEIRIDGLNVAAIGLHDLRSQLTIIPQDPILFSG
TLRMNLDPFGSYSEEDIWRVLELSHLRTFVGSQPAGLDFQCSEGGENLSVGQRQLVCLAR
ALLRKSRILVLDEATAAIDLETDDLIQATIRTQFETCTVLTIAHRLNTIMDYTRVLVLDK
GTVAEFDSPTNLIAARGIFYGMASDAGLA
NT seq 4590 nt   +upstreamnt  +downstreamnt
atggacgccctgtgcggctcaggggagctcggctccaagttctgggactccaatctgtcg
gtgtacacagacaacccagacctcactccctgcttccagaactccctgctggcctgggtc
ccctgcatctacctctgggccaccctgcccttctacctactctacctgtggcaccaccac
cgaggctacatcaccctctcccgcctctccaagctaaagacggtcttgggtgtcctgctg
tggtgcatctcctgggctgacctcttctactccttccatggcctgatccatggctgggcc
cctgcccccatcttctttgtcacccccttggtggtgggggtcaccatgctggtggccacc
ctgctgatccagtatgagcggctgcagggggtacagtcctcgggggtcctcatcatcttc
tggtttctgtgtgtggtctgcgccatcatccccttccgctccaagatcctttcaaccgtg
gcaaagggcaagatcttggaccctttccgctttgccacattctacatctactttgccctg
gtgctctgtgccctcatcctgtcctgcttcaaggagaagccaccatttttctcttcaagg
aatgtcgaccctaacccctgcccagaggctaatgctggcttcctctccttcctgactttc
tggtggttcacaaagatggccatccttggctaccgacgtcccctgaaggagcaagacctc
tggtccctgaacaaggaagaccactctgagatcgtggtgaagagtctgctggacgcctgg
aagaagcagcaaaagcgggcagcacgagacaagggcaaggcggcacctgggaagacagtg
tccactgaggatgaggagctgctgggggaccggcccgggccccgggagccctccttcctc
cgggccctgctggctgtctttggccccagcttcctcatcggcatgtgcttcctgctactc
cacgacctgctctccttcgtcaacccacagctactcagcatgctgatcagatttatttca
aaccccacggcccctgtctggtggggcttcctgttagccgggatgatgttcgtgtgctcc
atgatgcagactctgatctcacaccagtatttccaccgcatctttacaatggggttgagg
cttcgtacgggcatcatgggtgtcgtctatgggaaggctctggttatcaccaattcagtc
aaacgcaagttcaccttgggagaaatggtcaacctcatatcagtggatgcccagcgcttc
atggaccttgtcttccttctcaacttgctgtggtcagcacctctgcagatcatcctggca
gtctacttcctctggcagaaactgggtccctctattctggctggagttactctcatggtc
ttgctgatcccagtcaatggaggtgtggccatgaagatgcgagctttccaggtagagcaa
atgaagctcaaagactcgcgcatcaagctgatgagtgagatcctcggtggcatcaaggtg
ctgaagctgtacgcctgggagcccagcttcttgcaggaggtggaacgcatccggcaaagc
gagctccggctgctgcgcaagggcgcctacctccatgctgtgtccaccttcatctggatg
tgcacccccttcctggtgaccctcatcaccctcacggtatacgtgtctgtggacccaaac
aacgtgctggacgccgagaaggcctttgtgtctgtgtccctgttcaatatcttaaagaac
cccctcagcctgctgcctgttttaatcagcaacctgacccagaccagtgtctctctgaaa
cggatccagaacttcctgaaccaagatgaatttgacccccagtgtgtggaaagaaagacc
atcactccaggctatgctgtcaccatagacaatggcaccttcacctgggcccaggatcgg
ccccccaccctccacagcttagacatccaggtgccaaaagggaccctcgtggccgtggtg
gggcccgtgggctgtgggaagtcctccctgttgtctgccctgctgggagagatggagaag
ctggaaggcaaggtgtatgtgaagggttctgtggcctacgtgccccagcaggcatggatc
cagaactgcactcttcaggaaaatgtgctatttggccaagcactggaccccaagcgctac
aaccagactctggaggcttgtgccctgctagctgacctggaggtgctgtctggtggggac
cagacagagattggagagaagggcattaacttgtctgggggccagcagcagcgggttagt
ctggcccgagctgtatacagcaatgccgacatttttttgctggatgacccactatcagcc
gtggactcccatgtggccaagcatatctttgaccacgtcatcgggccagaaggtgtgctg
gcaagcaagacacgggtgctggtgacgcatggcatcagcttcctgccacagacagacttt
gtcgtagtgctagatgatggacaggtgtctgaggtgggcacctactcagctctcctccag
cgcaacggctcctttgccagcttcctccacaactatgcacctgatgaggacaagaaatac
caggaagaggatgtcaggactgcctttgaggatccagacgacgagcaggtgctgctgatt
gaagacacactcagcagccatgcagacctaatggataatgagccagtcatgtatgaggtc
cggaagcagtttatgagagagctgagtaccatgtccttggaaggagagggccacagtcgg
cctgtgcaccagagacgcctgagtacagcagaaaaggtagtgcaggcagcagaggtgaag
gcaaagggggcgctgatcgaggaggagaaggtggagatgggcagggtgaagctgaacatg
ttctgggattatgccaaggctatggggctctgtaccacactagtcatctgtctgctgtac
gcgggtcaaagcgcagctgccgttggggccaacatgtggctcagtgcctggaccaatgag
gctgcggtgggtggacaacagaataacacctccatgagactgggtgtctatgctgccttt
ggacttctgcaagggctcctggtggtgctgtcggccttcgcaatggcagtgggcagtgtc
caggctgcacactcgcttcaccgggcgctgctgcacaacatgatgcgctcgccacagtcc
ttctttgacactacaccctcaggccgtatcctcaaccgcttctccaaggatatctacgtc
atcgatgaggttctgggcccttccatcctcatgctgctgggttgtttttacaactccatt
ggcatcctcgtggtcattgtggtcaacacaccgctcttcgtggtggtcttcctgcctcta
gctgtcctctacctctttgtgcagcgcttctatgtggccacatcacagcaactgaagcgg
ctggaatctgtcagccgctcacccatattctcccacttttcggagacagtgactggctcc
agtgtcatccgggcctctggccgcagcaaggactttgaggccattagcaatgctaaggtg
gacaccaacctgaagagctgctaccccaacattgcctccaacaggtggctggggatccga
gtggagttcatggggaactgtgtcgtgctctttgttgcgctcttcgctgtggttgggaga
agcagcctgagcccaggattggtgggcctctccgtgtcctatgccctacaggtgacattt
gctctgaactggatgatacgaatgatgtcagaactggagtctaatatcgtggccgtggag
agagtcaaggagtactccaagacagagaccgaggccccctgggtggtggagggcagccga
cctcctgcggactggccctcagggggtgaagtggagttccgaaatttctctgcgcgctac
cggccgggcttggagctggtgctgaagaacctgagtctgcgcgtgcgcagtggtgagaag
gtggggatcgtgggccgcactggggctggcaaatcttccatgaccctgtgtctgtttcgc
atcctggaggccgcagagggtgaaatccgcattgacggcctcaatgtagcagccattgga
ctccatgacctgcgttctcagctaaccatcatcccccaggaccctatcctgttctcaggg
accctgcgtatgaacctggaccccttcggcagttactcagaggaagacatatggcgggtc
ctggagctgtctcacctgcgcacgtttgtgggctcccagccagcaggcctggacttccag
tgctccgagggaggggagaatctcagtgtgggtcagcggcagcttgtgtgcctggctcga
gccctccttcgcaagagccgcattctggttttagacgaggccacggccgccattgacctg
gagactgatgacctcatccaagctaccatccgcacccagtttgagacctgcacggtgctg
accatcgcacaccggctcaataccatcatggactacaccagggtcctggtcctggacaaa
gggacagtagctgaatttgattcgccaaccaacctcattgcagccagaggcatcttctat
gggatggccagcgatgccggacttgcctaa

DBGET integrated database retrieval system