KEGG   Rousettus aegyptiacus (Egyptian rousette): 107504550
Entry
107504550         CDS       T06036                                 

Gene name
ABL1
Definition
(RefSeq) tyrosine-protein kinase ABL1 isoform X1
  KO
K06619  abelson tyrosine-protein kinase 1 [EC:2.7.10.2]
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04012  ErbB signaling pathway
ray04014  Ras signaling pathway
ray04110  Cell cycle
ray04360  Axon guidance
ray04722  Neurotrophin signaling pathway
ray05200  Pathways in cancer
ray05206  MicroRNAs in cancer
ray05220  Chronic myeloid leukemia
ray05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    107504550 (ABL1)
   04014 Ras signaling pathway
    107504550 (ABL1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    107504550 (ABL1)
 09150 Organismal Systems
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    107504550 (ABL1)
  09158 Development and regeneration
   04360 Axon guidance
    107504550 (ABL1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107504550 (ABL1)
   05206 MicroRNAs in cancer
    107504550 (ABL1)
  09162 Cancer: specific types
   05220 Chronic myeloid leukemia
    107504550 (ABL1)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    107504550 (ABL1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ray01001]
    107504550 (ABL1)
Enzymes [BR:ray01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     107504550 (ABL1)
Protein kinases [BR:ray01001]
 Non-receptor tyrosine kinases
  ABL family
   107504550 (ABL1)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase F_actin_bind SH2 SH3_1 SH3_2 SH3_9 SH3_3 Kinase-like SH3_6
Other DBs
NCBI-GeneID: 107504550
NCBI-ProteinID: XP_015989328
LinkDB
Position
Unknown
AA seq 1150 aa
MGQQPGKVLGDQRRPSLPALHFIKGGGKKESSRHGGPHCNVFVEHEALQRPVASDFEPQG
LSEAARWNSKENLLAGPSENDPNLFVALYDFVASGDNTLSITKGEKLRVLGYNHNGEWCE
AQTKNGQGWVPSNYITPVNSLEKHSWYHGPVSRNAAEYLLSSGINGSFLVRESESSPGQR
SISLRYEGRVYHYRINTASDGKLYVSSESRFNTLAELVHHHSTVADGLITTLHYPAPKRN
KPTVYGVSPNYDKWEMERTDITMKHKLGGGQYGEVYEGVWKKYSLTVAVKTLKEDTMEVE
EFLKEAAVMKEIKHPNLVQLLGVCTREPPFYIITEFMTYGNLLDYLRECNRQEVNAVVLL
YMATQISSAMEYLEKKNFIHRDLAARNCLVGENHLVKVADFGLSRLMTGDTYTAHAGAKF
PIKWTAPESLAYNKFSIKSDVWAFGVLLWEIATYGMSPYPGIDLSQVYELLEKDYRMERP
EGCPEKVYELMRACWQWNPSDRPSFAEIHQAFETMFQESSISDEVEKELGKKGMRGVAST
LLQAPELPTKTRTSRRAAEHKDSTDVPETPHSKAPGEPDPLDHEPAVSPLLPRKERGPQD
GGLNEDERLLPKDKKTNLFSALIKKKKKTAPTPPKRSSSFREMDGQPERKGASEDEAREI
SNGALALPAPDTAEPLKSPKPSIGAGVPNGTFRESGGTGFRSPHLWKKSITLTSSRLAAS
EEESGISSSKRFLRSCSASCVPHGAKDTEWKSVTLPRDLPSTGRQFDSSTFGGHKSEKPA
LPRKRASENRPDQVTRGTVTPPPRLVKKTEEAADDVFRDAAESSPGSSPPSLTPKLLRRQ
AVLAPSSGVPHKEEAGKSSALGTPAAAEPVPLTSRAGPGASGGAGKAPAEESRVRRHKAS
SESPGRDKGKLSKLKPAPPPPPPVSVGKAGKSSQSPGSEAAGEAGASGKAKPPAVVVDAV
NSDAGRPSQPGEGGKKPALPAMPKPQSSTKPLGTPTSPAPAASALPSASSALAGDQPSST
AFIPLISTRVSLRKTRQPPERIASGAITKGVVLDSTEALCLAISRNSEQMASHSAVLEAG
KNLYTFCVSYVDSIQQMRNKFAFREAINKLENNLRELQICPATAGSGPAATQDFSKLLSS
VKEISDIVQR
NT seq 3453 nt   +upstreamnt  +downstreamnt
atggggcagcagcctggaaaagttcttggggaccaaagaaggccaagtttgcctgcccta
cactttatcaaaggaggagggaagaaggaatcatcgaggcatgggggtccacactgcaat
gtgtttgtggaacacgaagccctccaaaggccagtagcatctgactttgagccccagggt
ctgagtgaagcagctcgttggaactccaaggaaaaccttctcgccggtcccagtgaaaat
gaccccaacctttttgttgcactgtatgatttcgtggccagcggggataacactctaagt
ataactaaaggtgaaaagctccgggtcttaggctacaatcacaatggggagtggtgcgaa
gcccaaaccaagaatggccaggggtgggttccaagcaactacatcacccccgtcaacagt
ctggagaagcattcctggtaccacgggcccgtgtcccgcaacgccgccgagtacctgctg
agcagtggcatcaacggcagcttcttggtgcgggagagcgagagcagccccgggcagagg
tccatctcgctgagatatgaagggagggtgtaccactacaggatcaacactgcttccgat
ggcaagctctacgtctcctcggaaagccgcttcaacactctggccgagttggttcatcat
cactcaactgtggccgacgggctcatcaccactctccattacccagcccccaagcgcaac
aagcccaccgtctacggcgtgtcccccaactacgacaagtgggagatggagcgcacggac
atcaccatgaagcacaagctgggcgggggccagtacggggaggtgtacgagggcgtgtgg
aagaagtacagcctgacggtggccgtgaagaccctgaaggaggacaccatggaggtggaa
gagttcttgaaagaagctgcagtaatgaaagagatcaagcacccgaacctagtgcagttg
ctcggggtctgcacccgggagcccccgttctatataatcactgagttcatgacctatggc
aacctgttggattacctgagagagtgtaaccggcaggaggtgaacgctgtggtgctgctg
tacatggccacgcagatctcgtcagccatggagtacctggagaagaaaaacttcatccac
agagatcttgctgcccgaaactgcctggtaggggaaaaccacttggtgaaggtggctgat
tttggcctgagcaggttaatgacaggagatacctacacggcccacgccggggccaagttc
ccgatcaagtggaccgcgcccgaaagcctggcctacaacaagttctccatcaagtccgac
gtctgggcatttggagtattgctttgggaaatcgctacctatggcatgtcaccttacccg
ggaattgacctgtcgcaggtgtatgagctgctggagaaagactatcgcatggagcgccca
gaaggctgcccagagaaggtctacgaactcatgcgagcatgttggcagtggaatccctcc
gaccggccatcctttgctgaaatccaccaagcctttgaaacaatgttccaggagtccagc
atatcagatgaagtggaaaaggagctggggaaaaaaggcatgcgaggggttgccagtact
ttgctgcaggctccagagctgcccaccaaaaccagaacctccaggagagctgcagaacac
aaagactccaccgacgtgcctgagacaccccactccaaggccccgggagagcctgatcct
ctggaccacgagcctgctgtctctcctctgctccctcgaaaagagcgcggtccccaggat
ggtggcctcaatgaagatgaacgccttctccccaaagacaaaaagaccaacttgtttagc
gccctgatcaagaagaagaagaaaacagccccaacgccccccaaacgcagcagctccttc
cgggagatggacggccagcccgagcgcaagggggccagtgaggacgaggcccgcgaaatc
agcaacggggcgctagcgctcccagccccggacacggccgagccgctcaagtccccaaag
cccagcatcggggctggtgtccccaatggaaccttccgggagtcggggggcacaggcttc
cggtctccccacctgtggaaaaagtccatcacgctgaccagcagccggttagcagccagc
gaagaagagagtggcatcagctccagcaaacgcttcctgaggtcctgctctgcctcctgc
gtgccccacggggccaaggacacagagtggaagtccgtcacactgccgcgggacctgccg
tccacgggcaggcagttcgactcgtccactttcggagggcacaaaagtgagaagccagcg
ctgcctcgaaagcgggcaagtgagaacagacctgaccaggtgaccagaggcacagtgacg
cccccgcccaggctggtgaaaaagacggaggaagcggccgacgacgtcttccgagatgcg
gcggagtctagcccaggctccagcccgcccagcctgacgccaaaactcctgcgcaggcag
gccgtgctggccccttcctctggtgtcccccacaaggaagaggccgggaagtccagtgcc
ttggggacacccgccgcagccgagccggtgcccctcaccagcagagcggggccaggcgcg
tctggaggggccggcaaggcccctgccgaggagtccagagtgaggaggcacaaggcctcc
tccgagtccccagggagagacaaggggaagttgtccaagctcaaacctgccccgccgccc
ccaccacccgtctctgtcggcaaagcggggaagtcctctcagagcccgggctcggaggca
gccggggaggccggcgccagtgggaaggcgaaacccccggccgtggttgtggacgctgtg
aacagtgacgctggcagacctagccagccgggagagggcggcaaaaagcccgcgctcccg
gccatgccgaagccccagtcatccaccaagccgctggggaccccgaccagccccgcccca
gctgcctccgctctgccgtcagcatcctctgccctggccggggaccagccatcctccacc
gccttcatcccgctcatatcgacccgcgtgtctctccggaaaacccgccagcctcccgag
cgaatcgccagtggcgccatcaccaagggcgtggtcctggacagcaccgaggccctgtgc
ctggccatctccaggaactccgagcagatggccagccacagcgccgtgctggaagccggt
aagaacctctacacgttctgcgtgagctacgtggactccatccagcaaatgaggaacaag
tttgccttccgcgaggccatcaacaaactggagaataatctccgggagcttcagatctgc
ccagcaacagctggcagtggcccggcggccactcaggacttcagcaaactcctcagctcc
gtgaaggagatcagtgacattgtacagaggtag

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107509025
Entry
107509025         CDS       T06036                                 

Gene name
ABL2
Definition
(RefSeq) Abelson tyrosine-protein kinase 2 isoform X1
  KO
K08887  abelson tyrosine-protein kinase 2 [EC:2.7.10.2]
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04012  ErbB signaling pathway
ray04014  Ras signaling pathway
ray05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    107509025 (ABL2)
   04014 Ras signaling pathway
    107509025 (ABL2)
 09160 Human Diseases
  09166 Cardiovascular disease
   05416 Viral myocarditis
    107509025 (ABL2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ray01001]
    107509025 (ABL2)
Enzymes [BR:ray01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     107509025 (ABL2)
Protein kinases [BR:ray01001]
 Non-receptor tyrosine kinases
  ABL family
   107509025 (ABL2)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase F_actin_bind SH2 SH3_1 SH3_2 SH3_9 SH3_3 NHS RGS12_us1 SH3_6
Other DBs
NCBI-GeneID: 107509025
NCBI-ProteinID: XP_015996676
LinkDB
Position
Unknown
AA seq 1148 aa
MVLGTVLLPPNNYGRDQDTSLCCLCSEAAEAARPNLTDHFASCVEDAFEGDKTGGSSPET
LHRPYGCDVEPQALNEAIRWSSKENLLGATESDPNLFVALYDFVASGDNTLSITKGEKLR
VLGYNQNGEWSEVRSKNGQGWVPSNYITPVNSLEKHSWYHGPVSRSAAEYLLSSLINGSF
LVRESESSPGQLSISLRYEGRVYHYRINTTTDGKVYVTAESRFSTLAELVHHHSTVADGL
VTTLHYPAPKCNKPTVYGVSPIHDKWEMERTDITMKHKLGGGQYGEVYVGVWKKYSLTVA
VKTLKEDTMEVEEFLKEAAVMKEIKHPNLVQLLGVCTLEPPFYIVTEYMPYGNLLDYLRE
CSREEVTAVVLLYMATQISSAMEYLEKKNFIHRDLAARNCLVGENHVVKVADFGLSRLMT
GDTYTAHAGAKFPIKWTAPESLAYNTFSIKSDVWAFGVLLWEIATYGMSPYPGIDLSQVY
DLLEKGYRMEQPEGCPPKVYELMRACWKWSPADRPSFAETHQAFETMFHDSSISEEVAEE
LGRAASSSSVVPYLPRLPILPSKTRTLKKQVENKENIEGAQDATENSASSSAPGFARSVQ
VPSGSPALPRKQRDKSPSSLLEDAKETCFTRDRKGGFFSSFMKKRNAPTPPKRSSSFREM
ENQPHKKYELAGNFSSVASLQHADGFSFTPAQQEANLVPPKCCGGSLAQRNLCNDDAGGG
GGSGTAGGGWSGITGFFTPRLIKKTLGLRAGKPAASDDAAKPFPRSNSTSSMSSGLPEQD
RMAMTLPRNCQRAKLQLERTVSTSSQPEESVDRANDTLPKKSEEAAAPARERPKAKLLPR
GAAALPLRTPSGDPAVTEKDPPGVGGPPKSRERNGGARLGMAGVPEDGEQAGWTSPAKAA
AVLPTTHNHKVPVLISPTLKHTPADVQLIGTDSQGNKFKLLSEHQVTSSGDKDRPRRVKP
KCAPPPPPVMRLLQPPSPCSDPAEEPAAPPETQEGVRKAGKAGRPAAPPPQVPAPAASVS
PAKMANGTAGTKVALRKTKHAAEKISADKISKEALLECADLLSSAITEPVPNSQLVDTGH
QLLDYCSGYVDCIPHTRNKFAFREAVSKLELSLQELQVSSAAAGVPGANPVLNNLLSCVQ
EISDVVQR
NT seq 3447 nt   +upstreamnt  +downstreamnt
atggtcctcgggacagttctgcttccacctaataattatggccgagatcaggacacgtcg
ctttgctgcctgtgcagtgaagccgcagaagccgctcgacccaacttgacagatcacttt
gccagctgtgtggaggatgcatttgagggagacaagactggaggcagtagtccagaaacc
ctccaccgcccctatggttgtgacgttgaaccccaggcactgaacgaagccatcaggtgg
agctccaaggagaacttgctgggagccactgagagcgatcccaatctctttgttgcactt
tatgattttgtagcaagtggcgacaacacactgagcatcactaaaggtgaaaagttacga
gtccttggttacaaccagaatggtgagtggagtgaagttcgctctaaaaatggccaaggt
tgggtgccaagcaactacatcacgccagtgaacagcctggagaaacactcctggtaccat
ggacctgtgtcacgcagtgcagccgagtatctgctcagcagtttgatcaacggcagtttc
ctggtgcgagagagcgagagcagccctgggcagctgtccatctcgctcaggtacgagggg
cgcgtgtatcactacaggatcaacaccaccacggacggcaaggtgtatgtaactgccgag
agccgtttcagcaccttggccgagcttgttcaccatcactccacggtggccgatgggctg
gtgacgacattacactaccctgcacccaagtgcaacaagcctacggtttacggtgtgtcc
cccatccacgacaaatgggaaatggaacgaacagatattaccatgaagcacaaacttggg
ggtggtcagtacggagaggtttacgttggcgtctggaagaagtacagcctgacggtcgcc
gtgaaaacgctgaaggaagacacgatggaggtggaggagttcctgaaggaagccgcggtg
atgaaggagatcaagcacccgaatctggtccagctgctaggcgtgtgtactttggagcca
ccattttacatcgtgactgagtacatgccgtacgggaacttgcttgattaccttcgagaa
tgcagccgagaagaggtgactgcggttgtccttctttacatggccactcagatctcttct
gccatggagtatttagagaagaagaatttcatccacagggatctcgcagcccgtaactgc
ctcgtgggagaaaaccacgtggtgaaagtggccgacttcggcctaagtcggctgatgacc
ggagacacctacacggctcatgctggggccaagttccccatcaaatggacagcgcccgag
agcctggcctacaacaccttctccatcaaatccgacgtctgggcttttggagtactgctg
tgggaaattgctacgtatggaatgtcaccatatccaggtatcgacctgtctcaggtctat
gatctgctggaaaaagggtatcgaatggaacagcctgaaggatgcccgcccaaggtttac
gaacttatgagagcatgctggaagtggagccccgccgacaggccctcttttgctgaaaca
catcaggcttttgaaaccatgttccacgactccagcatttccgaagaggtagctgaggag
cttgggagagctgcctcctcctcctccgttgttccatacctgccccgattacctatactt
ccttccaagacccggacgctgaagaaacaggtggagaacaaggagaacatcgaaggggcc
caggatgccacagaaaactctgcttccagttcagcaccagggttcgctaggagtgtgcag
gtccccagcgggtctccagcactgcctcggaagcaaagagacaagtcacccagcagcctc
ttggaagatgccaaagagacatgcttcaccagggacaggaagggtggcttcttcagctcc
ttcatgaagaagagaaacgcccccacgcccccgaagcgcagcagctcctttcgggagatg
gagaatcagccccacaagaaatatgagctcgcgggtaacttctcatctgtcgcttctctg
cagcatgccgatgggttctccttcacgcctgcccagcaagaggcgaacctggtgcccccc
aagtgctgtggggggagccttgcacagaggaacctctgtaacgacgacgctggtgggggt
gggggcagtggcaccgctgggggcgggtggtctggcatcacgggcttctttacaccgcgc
ctaatcaaaaagacactgggcttacgagcaggtaaacccgcagccagtgatgacgctgcc
aagccttttccaaggtcaaactctacgtcttccatgtcctcagggcttccagagcaggat
aggatggcaatgacccttcccaggaactgccagagggccaaactccagctggaaaggaca
gtgtccacctcttctcagccagaagagagtgtggacagggccaatgacacgcttccgaaa
aaatcggaggaagctgctgctccagccagggagagaccgaaagctaagctgctgcccagg
ggggcggctgctctgcctctgagaacgccctctggggacccagccgttacagagaaggac
cctccaggggtggggggacccccaaagagcagggagaggaacggtggggcgcgactcggc
atggccggagtccccgaggatggcgagcaggcaggctggacgtccccggccaaggccgcg
gcggtcctcccaaccactcacaaccacaaagtgcccgtcctgatctcgcccaccctgaag
cacactccagccgacgtgcagctcatcggcacggactctcagggcaataaattcaagctc
ttgtctgagcatcaggtcacgtcctctggcgacaaggaccgaccccgacgggtaaaacca
aagtgcgccccaccccccccgccagtgatgagactactgcagcctccgtccccgtgctca
gaccccgcggaagagccggccgccccgccggaaacgcaggagggggtgcgaaaggccggg
aaagccgggaggcctgcggcgcctccgccccaagtgcctgcgcccgcagcttccgtctcg
ccagccaaaatggccaacggcacagcaggtactaaagtggctctgaggaaaaccaaacat
gcagctgagaaaatctcagcggacaagatcagcaaagaggccctgctggaatgtgccgac
ctactgtccagtgcaatcacggaaccggtgcccaacagccagctggtggacactggacac
cagctgctcgactactgctcaggctacgtggactgcatcccgcacactcgcaacaaattt
gccttccgagaggctgtgagcaaactggagctcagcctgcaggagctgcaggtgtcttcg
gcagcggccggtgtgcccggggcaaatcctgtccttaataacttactgtcatgcgtccag
gaaatcagcgatgtggtgcagaggtag

DBGET integrated database retrieval system