KEGG   Rousettus aegyptiacus (Egyptian rousette): 107504584
Entry
107504584         CDS       T06036                                 

Gene name
RALGDS
Definition
(RefSeq) ral guanine nucleotide dissociation stimulator isoform X1
  KO
K08732  ral guanine nucleotide dissociation stimulator
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04014  Ras signaling pathway
ray04015  Rap1 signaling pathway
ray04072  Phospholipase D signaling pathway
ray05200  Pathways in cancer
ray05210  Colorectal cancer
ray05212  Pancreatic cancer
ray05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    107504584 (RALGDS)
   04015 Rap1 signaling pathway
    107504584 (RALGDS)
   04072 Phospholipase D signaling pathway
    107504584 (RALGDS)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107504584 (RALGDS)
   05231 Choline metabolism in cancer
    107504584 (RALGDS)
  09162 Cancer: specific types
   05210 Colorectal cancer
    107504584 (RALGDS)
   05212 Pancreatic cancer
    107504584 (RALGDS)
SSDB
Motif
Pfam: RasGEF RasGEF_N RA Trypan_PARP
Other DBs
NCBI-GeneID: 107504584
NCBI-ProteinID: XP_015989416
LinkDB
Position
Unknown
AA seq 868 aa
MVQRMWAEAAGPAGGAEPLFPGSRRSRSVWDAVRLEVGGPDSCPVVLHSFTQLDPDLPRL
ESSTQEIGEELVNGLIYSISLRKVQLPHGGSKGQRWLGCENESALNLYETCKVRTVKAGT
LERLVEHLVPAFQGSDLSYVTVFLCTYRTFTTTQQVLDLLFKRYGRCDALTASSRYGCIL
PYSHEDGGPQDQLRDAISSILGTWLDQYSEDFCQPPDFPCLKQLVAYVQLNMPGSDLERR
AHLLLAQLEHAELAEAGLEALSPAPAPAPALKPEPEAALAPARASSPLPALELEPEPAPE
PESSPAPELEPAPAPEPSWPVPRASENGLSEEKPHLLGFPPDLVAEQFTLMDAELFKKVV
PYHCLGSIWSQRDKKGKEHLAPTVRATVTQFNSVANCVITTCLGDRNVTARDRARVVEHW
IEVARECRVLKNFSSLYAILSALQSNSIHRLKKTWEEVSRDSFRIFQKLSEIFSDENNYS
LSRELLIKEGTSKFATLEMNPKRAQKRPKETGVIQGTVPYLGTFLTDLVMLDTAMKDYLY
GRLINFEKRRKEFEVIAQIKLLQSACNNYSLEPEQHFGAWFRAMERLSETESYNLSCELE
PPSESASNTLKAKKNMAIVKRWSDRQAPSTELSTSGSSHSKSCDQLRCGPYLSSGDMADT
LSVHSAGSSSSDVEEISMSFVPESPDGQEKKFWESTSPWSPETSGISSASSSTSSSSAST
TPVAGARTHKRSVSGVSSHSASLPLYNQQVGDSCIIRVSLDVDNGNMYKSILVTSQDKAP
AVIRKAMDKHNLDEDEPDHYELVQVISDERKLKIPENANVFYAMNSTANYDFVLKRRPFT
KGAKVRHGASSTLPRMKQKGLKIAKGIF
NT seq 2607 nt   +upstreamnt  +downstreamnt
atggtgcagcgcatgtgggccgaggcggccgggcctgcgggcggcgccgagccgctgttt
cccggctcccggcggagccgcagcgtgtgggacgccgtgcgcctggaggtgggcggcccc
gacagctgccccgtggtgctgcacagcttcacgcagctcgaccccgacttgccgcgcctg
gagagctccacgcaggagatcggtgaggagctggtcaacgggctcatctactccatctcc
ctgcgcaaggtgcagctgccccacggcggcagcaagggccagcgctggctcgggtgtgaa
aatgagtcggccctgaacctgtatgagacctgcaaggtacggaccgtgaaggcgggcacg
ctggagaggctggtggagcacctggtgcccgccttccagggcagcgacctgtcctacgtc
accgtcttcctgtgcacctaccgaaccttcaccaccacgcagcaggtgctggacctgctc
ttcaaaaggtacggtagatgtgacgccctcacggcctcctctagatacggctgcatcctc
ccctactcccacgaggacggcggcccccaggaccagctgagagatgccatctcctccatc
ctgggcacctggctggaccagtactcggaggacttctgccagcccccggacttcccctgc
ctcaagcagctggtggcctacgtgcagctcaacatgcccggctccgacctggagcgccgg
gcgcaccttctcctggctcagctggagcacgcagaactggccgaggcagggctggaggct
ctgtcgccggccccagctccggcgccggcgctgaaaccagagccagaggcagctctcgcg
ccagcccgagcgtccagcccattgccagcgctagagctggagccagagccggctccggag
ccggaatcctcgccggccccagagctggagccggcgcccgcgccggagccctcctggcct
gtgccccgggcgtcggagaatgggctgagcgaggagaagcctcacctcctggggttcccg
cctgacctggtggcagagcagttcaccctgatggacgcggagctgttcaagaaggtggtg
ccttaccattgcctgggctccatctggtcccagcgggacaagaaaggcaaggagcacctg
gctcccaccgtccgggccaccgtcacccagttcaacagtgtggccaactgcgtcatcacc
acctgcctcggggaccggaacgtgacggcccgggacagggcccgggtggtggagcactgg
attgaggtggccagggagtgtcgggtcctcaagaacttctcgtccctctacgccatcctc
tccgcgctgcagagcaactcgatccaccggctgaagaagacgtgggaagaggtgtccagg
gacagcttccggatctttcagaagctgtcggagattttctcggacgagaacaactactca
ctgagcagggagctgctcatcaaggaagggacctccaagtttgctaccctggagatgaac
cccaagcgggcacagaagcggccgaaggagacgggcgtcatccagggcaccgtcccctac
ctgggcacgttccttaccgacctggtgatgctggacaccgcgatgaaggactacctgtat
gggagactgatcaacttcgagaagagaaggaaggaattcgaagtgatcgctcagatcaag
ctgctgcagtcggcctgcaacaattacagcctcgagcccgagcagcactttggggcctgg
ttccgggccatggagcggctcagcgagaccgagagctacaacctgtcgtgtgagctggag
cccccgtccgagtcggccagcaacacgctgaaggccaagaagaacatggccatcgtcaag
cgctggagcgaccgccaggcccccagcacggagctgagtaccagcggcagctcccactcc
aagtcctgtgaccagctcaggtgtggcccctacctcagcagcggggacatggccgacaca
ctcagcgtgcactcggccggctcctccagctccgacgtggaggagatcagcatgagcttt
gtccccgagtcccccgatggccaagaaaagaagttctgggagtcgacgtccccgtggtcc
ccggagacctccggcatcagctccgcctccagcagcacctcctcgtcctcagcctccacc
acgcccgtggccggcgcccgcacccacaaacgctcagtctcgggggtcagcagccacagc
gcctccctgccgctctacaaccagcaggtgggcgactcctgcatcatccgtgtcagcctg
gacgtggacaatggcaacatgtacaagagcatcctggtgaccagccaagataaggctcca
gctgtaatccgcaaggccatggacaaacacaacctggacgaggacgagccagaccactat
gagctggtgcaggtcatttcagacgaacgaaagctgaagatccccgagaacgccaatgtg
ttctacgccatgaactcaactgccaactacgacttcgtcctgaagagacgccccttcacg
aagggggcaaaggtcaggcacggagccagctcgacgctgccccgcatgaagcagaaagga
ctcaagatcgccaagggcatcttctga

DBGET integrated database retrieval system