KEGG   Rousettus aegyptiacus (Egyptian rousette): 107504647
Entry
107504647         CDS       T06036                                 

Gene name
PGR
Definition
(RefSeq) progesterone receptor isoform X1
  KO
K08556  progesterone receptor
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04114  Oocyte meiosis
ray04914  Progesterone-mediated oocyte maturation
ray04915  Estrogen signaling pathway
ray05224  Breast cancer
Brite
KEGG Orthology (KO) [BR:ray00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    107504647 (PGR)
 09150 Organismal Systems
  09152 Endocrine system
   04915 Estrogen signaling pathway
    107504647 (PGR)
   04914 Progesterone-mediated oocyte maturation
    107504647 (PGR)
 09160 Human Diseases
  09162 Cancer: specific types
   05224 Breast cancer
    107504647 (PGR)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ray03000]
    107504647 (PGR)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:ray03310]
    107504647 (PGR)
Transcription factors [BR:ray03000]
 Eukaryotic type
  Zinc finger
   Cys4 estrogen receptor-like
    107504647 (PGR)
Nuclear receptors [BR:ray03310]
 3. Estrogen like
  3C. 3-Ketosteroid receptor
   107504647 (PGR)
SSDB
Motif
Pfam: Prog_receptor Hormone_recep zf-C4
Other DBs
NCBI-GeneID: 107504647
NCBI-ProteinID: XP_015989496
LinkDB
Position
Unknown
AA seq 942 aa
MTELKAKASQASQAPHVAGGAPSPTQDGSLLLGRPDTGPLQASQTSDVSRVVSAIPISLD
RLLFTRPCQGQDQDEKTQDQKALSEVEGEYPRVEAIRGAGGGSSRPPVKDSGLLDSVLDT
LLAPSGPGQNHASPSTYEATSPWCLFGPELPVEPRATPATQGVFPSLMNRPEDKADDSSR
TAAGHKVLPRVLSSCRQLLPSTSGNHHWPGAAAKPCPQPTVMEVEEEADSESEGSVGPIL
KDKLQPLGVTAAEGGAAATAPGAAEGGVVLVPKEDARFSAPRVALAEQDKPAAPGRSPMA
TMVMDFIHVPVLPLNSAFLAARTRQLLEAENYDGGATTVSAFAASRGSPPASSTPVAAGD
FPDCAYARDAEAKEDAFPPYGDFQAPALKIKEEEEGAEASARSPRQYLVTGANPAVFSDF
QQAPPPLRASSSRPGEAAVAVASTSSSVSSASSSGSTLECILYKAEGAPPQQGAFAPPPC
KAAGAGSCLLPRDSLPSTSASASATGAASALYPPLGLNGLPQLSYQAAVLKEGLPQVYSP
YLNYLRPDSEASQSPQYSFDSLPQKICLICGDEASGCHYGVLTCGSCKVFFKRAMEGQHN
YLCAGRNDCIVDKIRRKNCPACRLRKCCQAGMVLGGRKFKKFNKVRVMRALDAVALPPPV
GIQNESQALSQRITFSPNQELQLLHPVINLLMSIEPEMIYAGYDNTKVHNSSSLLSSLNQ
LGERQLLSVVKWSKLLPGFRNLHIDDQITLIQYSWMSLMVFGLGWRSYKHVSGQMLYFAP
DLILNEQRMKESSFYSLCLTMWQISKEFVKLQISQEEFLCMKVLVLLNTIPLEGLRSQNQ
FEEMRSNYIRELIKAIGLRQKAVVPSSQRFYQLTKFLDSLHDVAPVVSSITFQNEPLKWY
AKFCLHKCIYIFVRRKFITFIRYSRVFKCKKYREKFKISEIG
NT seq 2829 nt   +upstreamnt  +downstreamnt
atgacagagctgaaggcaaaggcttcccaggcttcccaggctccccacgtggcggggggc
gcgccctcccccacccaggacggatctcttctactgggacgccccgacacaggccccctc
caggcgagccagacctcggacgtctcgcgggtagtctcggccatacccatctccctggat
aggctgctcttcactcggccctgccagggacaggaccaagacgaaaagacacaggatcag
aaggcactgtcagaagtggagggggagtatcccagagttgaagccataaggggtgcagga
ggtggcagctctagaccaccagtaaaggacagcgggctgctggacagtgttttggacact
ctactggcaccctcaggtcccggacagaaccacgccagcccttctacctacgaggccacc
agtccttggtgcctgtttggccccgaacttcccgtagagcctagggctacccctgccacc
cagggggtgtttccctcgctcatgaaccggccagaggacaaggctgacgacagctccagg
actgcagctggccataaagtgctgcccagggtcctgtcatcgtgccggcagctgctgccc
tcgacctctgggaaccatcactggcctggggccgccgcgaagccgtgtccgcagcccact
gtgatggaagtggaggaggaagctgactccgagtccgagggctcggtaggtccaattctg
aaggacaaactccagcctctgggagtcacggcggccgaaggaggagctgcggccactgct
cctggggcggccgaaggaggtgtcgtcctggttcccaaggaagatgcccgcttttccgcg
cccagggtcgccctggcggagcaggacaagccagccgcgcctgggcgctccccgatggcc
accatggtgatggattttatccacgtgcccgtcctgccactcaactcggctttcctggcc
gcccgcacccggcagctactggaggcggagaactatgacggtggggccacgactgtcagc
gcctttgccgcgtcgcggggttcacccccagcctcgtccaccccagtcgccgccggcgac
ttcccagactgcgcttacgcgcgggacgccgaggccaaagaggacgcgttcccgccgtac
ggtgacttccaggcccccgccctgaagattaaggaggaggaggaaggcgccgaggcgtcc
gcgcgctccccgcggcagtacctggtgactggtgccaaccccgctgtcttctccgatttc
cagcaggcgccgccgcctctgagagcgtcgtcctccagacctggggaagcggcggtggca
gttgcatccaccagttcctctgtctcgtccgcgtcctcgtcggggtcgaccttggagtgc
atcctgtacaaagcagagggcgcgccgccccagcagggcgcgtttgccccaccgccctgc
aaggctgcgggcgcagggtcctgcctgctgccgcgggacagcctgccctccacctcggcc
tcagcctccgccaccggggcggcctctgcgctctacccgccgctcggcctcaacgggctt
ccgcagctcagctaccaggccgcggtgctcaaggagggcctgccgcaggtctactcgccc
tatctcaactacctgaggccggattcagaagccagccagagcccacagtacagcttcgac
tcattgcctcagaagatttgtttaatctgtggggatgaagcatcaggctgtcattatggt
gtccttacctgtgggagctgtaaagtcttctttaaaagggctatggaagggcagcacaat
tatttatgtgctggaagaaacgactgcatcgttgataaaattcgcagaaaaaactgccca
gcatgtcgccttagaaagtgctgtcaggctggaatggtccttggaggtcgaaagtttaaa
aagttcaataaagtcagagttatgagagcactagatgctgttgctctcccaccgccagtg
ggcattcaaaatgaaagccaagccctaagccagagaatcactttttcaccaaatcaagaa
ttacagttgttacacccagtgatcaacctgctaatgagcattgaacctgagatgatctac
gcaggatatgacaacaccaaagttcataactccagttctttgctgtcaagtcttaatcag
ctaggcgagagacaacttctttcagtagtcaagtggtctaaattactgccaggttttcga
aacttacatattgatgaccaaataactctcatccaatattcttggatgagcttaatggtg
tttggactaggatggagatcctataaacatgtcagtgggcagatgctatattttgcacct
gatctaatactaaacgaacagcggatgaaggaatcatcattctattcattatgccttacc
atgtggcagatctcaaaggagtttgtgaagctccaaattagccaagaagagtttctctgt
atgaaagtattggtacttcttaatacaattcctttggagggactaagaagtcaaaaccag
tttgaagaaatgagatcaaactacattagagagctcatcaaggcaattggtttgaggcaa
aaagcagttgtccctagttcacagcgtttttatcaacttacgaagtttcttgatagcttg
catgatgtagctcctgttgtctcctcgattactttccaaaatgaacctttaaaatggtat
gcaaaattttgtctacataagtgtatatacatttttgtgagaaggaaatttataacgttt
atcagatattcaagagtttttaaatgcaaaaaatatagagaaaagtttaaaatctctgaa
ataggttga

DBGET integrated database retrieval system