KEGG   Rousettus aegyptiacus (Egyptian rousette): 107504680
Entry
107504680         CDS       T06036                                 

Gene name
FCER1G
Definition
(RefSeq) high affinity immunoglobulin epsilon receptor subunit gamma isoform X1
  KO
K07983  high affinity immunoglobulin epsilon receptor subunit gamma
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04071  Sphingolipid signaling pathway
ray04072  Phospholipase D signaling pathway
ray04611  Platelet activation
ray04625  C-type lectin receptor signaling pathway
ray04650  Natural killer cell mediated cytotoxicity
ray04664  Fc epsilon RI signaling pathway
ray05152  Tuberculosis
ray05310  Asthma
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04072 Phospholipase D signaling pathway
    107504680 (FCER1G)
   04071 Sphingolipid signaling pathway
    107504680 (FCER1G)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    107504680 (FCER1G)
   04625 C-type lectin receptor signaling pathway
    107504680 (FCER1G)
   04650 Natural killer cell mediated cytotoxicity
    107504680 (FCER1G)
   04664 Fc epsilon RI signaling pathway
    107504680 (FCER1G)
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    107504680 (FCER1G)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    107504680 (FCER1G)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ray04147]
    107504680 (FCER1G)
Exosome [BR:ray04147]
 Exosomal proteins
  Exosomal proteins of microglial cells
   107504680 (FCER1G)
SSDB
Motif
Pfam: TCR_zetazeta ITAM
Other DBs
NCBI-GeneID: 107504680
NCBI-ProteinID: XP_015989564
LinkDB
Position
Unknown
AA seq 85 aa
MKPAVVLLLLLLAERAAALGEPQLCYILDAILFLYGLVLTLLYCRLKIQVRKAAVAYEKS
EGVYTGLSTRTQETYETLKHEKPPQ
NT seq 258 nt   +upstreamnt  +downstreamnt
atgaagcctgccgtggtcttgctgttgctccttctggctgaacgggcagcggccttggga
gagcctcagctctgctatatcctggacgccatcctgtttctgtatggcctcgtcctgact
ctgctctactgtcggctcaagatccaggtgcggaaggcagccgtggcctacgagaaatcg
gaaggcgtctacacgggcctgagcacccggacccaggagacctacgagaccctgaagcat
gagaagccaccacagtga

DBGET integrated database retrieval system