KEGG   Rousettus aegyptiacus (Egyptian rousette): 107504798
Entry
107504798         CDS       T06036                                 

Gene name
BRCA2
Definition
(RefSeq) breast cancer type 2 susceptibility protein isoform X1
  KO
K08775  breast cancer 2 susceptibility protein
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray03440  Homologous recombination
ray03460  Fanconi anemia pathway
ray05200  Pathways in cancer
ray05212  Pancreatic cancer
ray05224  Breast cancer
Brite
KEGG Orthology (KO) [BR:ray00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    107504798 (BRCA2)
   03460 Fanconi anemia pathway
    107504798 (BRCA2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107504798 (BRCA2)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    107504798 (BRCA2)
   05224 Breast cancer
    107504798 (BRCA2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:ray04121]
    107504798 (BRCA2)
   03036 Chromosome and associated proteins [BR:ray03036]
    107504798 (BRCA2)
   03400 DNA repair and recombination proteins [BR:ray03400]
    107504798 (BRCA2)
Ubiquitin system [BR:ray04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   BRCC complex
    107504798 (BRCA2)
Chromosome and associated proteins [BR:ray03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     107504798 (BRCA2)
DNA repair and recombination proteins [BR:ray03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    BRCA complex
     107504798 (BRCA2)
   FA (Fanconi anemia) pathway
    Downstream FA components
     107504798 (BRCA2)
SSDB
Motif
Pfam: BRCA-2_helical BRCA-2_OB1 Tower BRCA-2_OB3
Other DBs
NCBI-GeneID: 107504798
NCBI-ProteinID: XP_015989807
LinkDB
Position
Unknown
AA seq 781 aa
MHHVSLEPITCAPFCTTKARQETHTPRFTAPGQEFLSKSHFYEHLEKSSSNLSVSRQPFC
KVPATRNEKRRHSMTTDKQMKVFVPPFKTKSHFHGDEPCVSSCTNLEECTQKHIGKHDSG
VSENNTDDSEICQPPKDNASQAATVISTKCEEPPLGLIPNLQNARDMQDMRIKQKHRQRV
CPQPGSLSLARASGAPRIPMRAAVGGRPPSACPPEQLYMYGVSKHCVKINSKNAESFQFH
VQDYFGKESLRAGKGIQLADGGWLVPSDDGKAGKEEFYRALCDTPGVDPKLISRVWVHNH
YRWIIWKLAAMEFAFPKEFASRCLNPETVLLQLKHRYDIEIDGSRRSAIKKILERDDTAA
KTLVLCVSEVIPSGAHLSDAHGRKTSGAAASGAAVVELTDGWYAVRAQLDPPLSALLRTG
RLGVGHKVITHGVELLGPPEACAPLEASESLMLKISANSTRPACWDAKLGFCADPRPFPV
PLSSLFSDGGNTACVDVVIQRAYPVQWVEKTSSGLYIFRNEREEEKEAAKYAETQQRKLE
ALFTKIQAEFEEQEESITRRCLPSRALTRQQVRALQDGAELYEAVRAAPDPAYLESYFSE
EQLRALNNHRQMLNDKKQAQIQLEFRKAVGSAEQGDQVSSRDVTPVWKLRVISHEKKGKD
SVILSIWRPSSDLYSLLTEGQRYRIYHLATSKPKHKSGQANVQLTATKRTQYQQLPASDG
ILVQVYQPRRPLPFTQLSNPDFQPPCAEVDLIGFVISIVRKIGFTCVIIWCFTFLFLTHF
T
NT seq 2346 nt   +upstreamnt  +downstreamnt
atgcatcacgtttctttagagccaattacctgtgcacccttttgcacaactaaggcacgg
caggagactcacactccacgctttacagctcctggtcaagaatttctgtcaaaatctcat
ttttatgaacacctggagaaatcatcaagcaatttatcagtttcaaggcagccattttgt
aaggtccctgccacaagaaatgagaaaaggagacactcgatgactacagacaaacagatg
aaagtctttgtcccgccttttaagacgaaatcacattttcacggagacgaaccttgtgtt
agcagctgtactaatttggaggaatgcacacaaaaacacataggcaaacacgactctggt
gttagtgaaaataatactgatgacagtgaaatctgtcagcctcccaaagataacgccagt
caagcggcaaccgtaatctccacaaagtgtgaagaaccacctttaggtttaattcccaat
cttcagaatgccagagacatgcaggatatgcggattaaacagaagcacaggcagcgcgtc
tgtccccagccaggcagtctgtccctcgccagggcgtccggcgcgccccgaatccccatg
cgggcagcggtgggaggccgcccgccctcggcatgtcctcctgagcagctgtatatgtat
ggcgtctctaaacactgcgtgaaaattaacagcaaaaacgctgagtcttttcagtttcac
gttcaagattattttggtaaggaaagtttacgggctggaaagggaatccagttggctgac
ggcggctggcttgtaccctccgacgatggaaaggctggaaaggaagaattttatagggca
ctgtgcgacaccccaggcgtggaccccaagctcatctctagagtctgggtccacaatcac
tatagatggatcatatggaaactggcggccatggaatttgcctttcccaaggaattcgcc
agcagatgcctaaaccccgagaccgtgctgcttcagctgaaacacagatatgatatagaa
attgacggaagcagaagatcagctataaaaaagatactggaaagggatgacacggctgca
aaaacactcgtgctctgtgtttcggaagtaatcccgtcaggcgcgcatctgtccgatgct
cacggcaggaaaaccagcggcgcggcagccagcggcgcggccgtcgtggaactgacggac
ggctggtacgccgtcagggcccagctcgacccgcccctgtcggcgctcctgcggaccggc
aggctgggcgtcggccacaaggtcatcacgcacggcgtggaactgctgggccctcccgag
gcctgcgcccctctggaagcctccgagtctctcatgttgaagatttctgccaacagcaca
cggcccgcgtgctgggatgccaagcttgggttctgcgcggaccccagaccttttcctgtc
cccttgtcgtcacttttcagtgacggaggaaacactgcctgtgtcgacgtggttatccag
agagcataccccgtccagtgggtggagaagacttcgtctggactatacatatttcgcaat
gaaagagaagaagaaaaggaagcagcaaaatatgcagagacccaacaaaggaaactggaa
gctttattcactaaaatccaggcagaatttgaagagcaggaagaaagcataaccagacgg
tgtcttccgtcgcgtgccctaaccagacagcaagtgcgtgccctgcaggacggtgccgag
ctctatgaagcagtgagggccgcgccagaccccgcttacctggagagttattttagcgaa
gagcagttgagagccttgaataatcacagacagatgttgaatgacaagaagcaagcgcag
atccagctggagttcaggaaggctgtgggatctgctgagcaaggggaccaggtgtcatca
agggatgtgacacctgtgtggaagctgcgagtcatcagccatgagaaaaaaggaaaagat
tcagttatactgagtatctggcgtccgtcatcagatttatattccctgctaacggaggga
cagagatacagaatctatcatctcgcaacatcaaaacctaaacataaatctggacaagct
aacgtgcagttaacagcaacaaaacggactcagtatcaacaactgccggcttcagatgga
atcctggtccaagtttaccagccacggcggccccttccctttacccagctctcaaatcca
gacttccagccaccgtgtgctgaggtggacctgataggatttgttatttccattgtgaga
aaaataggtttcacatgcgtgatcatctggtgtttcacttttctctttctgactcatttc
acatag

DBGET integrated database retrieval system