KEGG   Rousettus aegyptiacus (Egyptian rousette): 107504912
Entry
107504912         CDS       T06036                                 

Gene name
EIF4G1
Definition
(RefSeq) LOW QUALITY PROTEIN: eukaryotic translation initiation factor 4 gamma 1
  KO
K03260  translation initiation factor 4G
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray03013  RNA transport
ray05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:ray00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    107504912 (EIF4G1)
 09160 Human Diseases
  09166 Cardiovascular disease
   05416 Viral myocarditis
    107504912 (EIF4G1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:ray03019]
    107504912 (EIF4G1)
   03012 Translation factors [BR:ray03012]
    107504912 (EIF4G1)
Messenger RNA biogenesis [BR:ray03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     107504912 (EIF4G1)
   mRNA cycle factors
    Stress granule specific factors
     107504912 (EIF4G1)
Translation factors [BR:ray03012]
 Eukaryotic type
  Initiation factors
   eIF-4
    107504912 (EIF4G1)
SSDB
Motif
Pfam: MIF4G MA3 W2
Other DBs
NCBI-GeneID: 107504912
NCBI-ProteinID: XP_015990027
LinkDB
Position
Unknown
AA seq 1616 aa
MNKAPQPTGPPPAPSPGLPQPAFPPGQTAPVVFSTPQATQMNTPSQPRQGGFRSLQHFYP
SRAQPPSSAASRVQSAAPARPGPAAHVYPAGSQVMMIPSQISYSASQGTYYIPGQGRSTY
VVPTQQYPVQPGAPSFYPGASPTEFGTYAGAYYPAQGVQQFPAGVAPAPVLMNQPPQIAP
KRERKTIRIRDPNQGGKDITEEIMSGARTASTPTPPQTGGGLEPQANGETPQVAVVVRPD
DRSQGAIIGGRPGLPGTEHSPSESQPSSPSPTPSPPPILEPGSEPNLAVLSIPGDTITTG
MIQMSVEESTSMSRETGEPYCLSPEPTPLAEPILEVEVTLSKPIPESEFSSSPLQVSIPL
ASPNMEILPEPNGTVPSEDLEPELESNPELAPLPPPACSSESPTPIAPTAQPEELLNGAP
SPPAVDLSPVSEPEVKEISAPVAPPTVLTATPVIVLPATSPALEEEMEEEEEEEEAGEMG
EAEGEKGGEELLSPEDTPVPVHLSQNLEAAAATPVAVSVPKRRRKIKDLNKKEAVGDLLD
AFKEVNPGVPEVENQPPVGNNPGLDPEDSSVPPRPEEADETWDAKEDKIHNAENIQPGEQ
KYEYKSDQWKPLNLEEKKRYDREFLLGFQFIFASMQKPEGLPHISDVVLDKANKTPLRPL
DPTRLPGINHGPDFTPSFANLGRPALSNRGPPRGGPGGELPRGPAGLGPRRSQQGPRKEP
RKIIATVLMTEDIKLNKAEKAWKPSSKRTAADKDRGEEDADGSKTQDLFRRVRSILNKLT
PQMFQQLMKQVTQLAIDTEERLKGVIDLIFEKAISEPNFSVAYANMCRCLMALKVPTTEK
PTVTVNFRKLLLNRCQKEFEKDKDDDEVFEKKQKEMDEAATAEERGRLKEELEEARDIAR
RRSLGNIKFIGELFKLKMLTEAIMHDCVVKLLKNHDEESLECLCRLLTTIGKDLDFEKAK
PRMDQYFNQMEKIIKEKKTSSRIRFMLQDVLDLRRSNWVPRRGDQGPKTIDQIHKEAEME
EHREHIKVQQLMAKGSDKRRGGPPGPPINRGLPLVDDGGWNTVPISKGSRPIDTSRLTKI
TKPGSIDSNNQLFAPGGRLSWGKGSSGGSGAKPSDAASEAARPATSTLNRFSALQQAAPT
ESTENRRVAQRSSLSRERGEKAGDRGDRLERSERGGDRGDRLDRSRTPATKRSFSKEVEE
RSRERPSQPEGLRKAASLSEDRDRGRDAVKREATLPPVSPPKSVLSEEELEKKSKAIIEE
YLHLNDMKEAVQCVQELASPSLLFIFVRHGIESTLERSAIAREHMGRLLHQLLCAGHLST
AQYYQGLYEILELAEDMEIDIPHVWLYLAELVTPILQDSGVPMGELFREITKPLRPLGKA
ACLLLEILRLLCKNMGPKKVGALWQEAGLSWKEFLPEGQDVGAFVAEQKVEYTLGEESEV
PGQRLLSSEELSRQLEKLLKEGSSNQRIFDWIEANLSEQQRASNTLVRALMKTVCSSAII
FETPLRVDVAETSLRVDVEVLKVRAKLLQKYLCDEQKELQALYALQALVVTLEQPPNLLR
LFFDVLYDEDVVKEDAFYSWESSKDPAEQQGKGVALKSVTNFFTWLREEEEESDHN
NT seq 4851 nt   +upstreamnt  +downstreamnt
atgaacaaagctccacagcctacaggccccccacccgccccatcccctggactcccacag
ccagcgtttcccccggggcagacagcaccggtggtgttcagtacgccacaagcgacacaa
atgaacacgccttctcagccccgccagggaggattcaggtctctgcagcacttctaccct
agccgggcccagcccccgagcagtgcagcctcccgagtgcagagtgcagcccccgcccgc
cctggcccagctgcccatgtctaccctgctggatcccaagtaatgatgatcccttcccag
atctcctactcagcctcccaggggacctactacatccctggacaggggcgttccacatac
gttgtcccgacacagcagtatcctgtgcagccaggagccccaagcttctatccaggtgca
agccctacagagtttgggacctatgctggcgcctattacccagcccagggtgtgcaacag
tttcccgctggtgtggcccccgccccagttttgatgaaccagccaccccagattgctccc
aagagggagcggaaaacgatccgaattcgcgatccaaaccaaggagggaaggatatcaca
gaggaaatcatgtctggggcccgaaccgcctctacacccacccctccccagacgggaggc
ggtctggagcctcaagctaatggggagacaccccaggttgctgttgttgtccggccagat
gaccggtcacagggagcaatcattgggggccggccagggctgcctggcacagagcatagt
ccttcagaatcccagccttcatcaccttctccgaccccatcaccacccccaatcttggaa
ccagggtctgaacctaatctcgcagtcctctctattcctggggacactataacaacgggg
atgatacaaatgtctgtagaagaatcaacttccatgtcccgtgaaactggggagccatat
tgcctctctccagaacccactccccttgctgaacccatactggaagtagaagtgacactt
agcaaaccaattccagaatctgagttctcttccagtcctctccaggtttccatccccttg
gcatctcctaacatggaaattcttcctgaacctaatggcacagtcccatccgaggatctg
gaaccagagctggagtcaaacccagagcttgcccctcttcctcccccggcttgttcctcc
gaatcccccacgcctattgccccaaccgcccaacctgaagaactgctcaacggagccccc
tcaccaccagccgtggacttaagcccagtcagtgagccagaggtcaaggagatatcagca
ccagtggctcccccaaccgtcctcactgccactccagttatagttcttccagctacttcc
cctgccctggaggaggaaatggaggaagaggaagaagaggaagaagcaggagaaatggga
gaagctgagggtgaaaagggaggagaggaactgctctccccagaggacacccctgttcca
gtccacctgtcccagaatttggaggcagcagcagccaccccagtggcagtatctgtgcca
aagaggagacggaaaattaaggatctcaataaaaaggaagctgtaggagaccttctagat
gccttcaaggaggtgaacccaggagtaccagaggtggaaaatcagcctcctgtaggcaat
aatcctggtctagaccctgaggacagcagtgtgcccccacggcctgaggaagcagatgag
acctgggacgcaaaggaagacaaaattcacaatgctgagaacatccagccaggggaacag
aagtatgaatataaatcagatcagtggaagcctctaaatcttgaggagaaaaagcgttat
gaccgtgagttcctgcttggctttcagttcatctttgccagtatgcagaagccagaggga
ttgccccatatcagcgatgtggtgttggataaggccaataaaacaccactgcggccactg
gatcccactagacttccaggcataaatcatggcccagacttcactccatcctttgccaac
cttggccgaccagcccttagcaaccgtgggcccccaaggggtgggccaggtggggagctg
ccccgagggccggcaggtttaggaccccggcgctcccagcagggcccccgaaaggagcca
cgcaagattattgccacagtgttaatgactgaagatataaagctaaacaaagcagagaag
gcctggaaacccagcagcaagcggacagcagctgataaggaccgaggggaagaggatgcc
gatggcagcaaaacccaggacctgttccgtagggtgcgctccattctcaataagctgaca
ccccagatgttccagcagctgatgaagcaggtgacgcagctggccatcgacacagaggaa
cgcctgaaaggtgtcattgacctcatcttcgagaaggccatttcagagcccaacttctct
gtggcctatgccaacatgtgccgctgcctcatggcgctgaaagtgcccactacagaaaag
ccaacagtgactgtgaactttcgaaaactgttgttgaatagatgtcagaaggagtttgaa
aaagacaaagatgatgatgaagtttttgagaagaagcaaaaagagatggatgaagctgct
acggcagaggaacggggacgcctgaaggaagagctggaagaggctcgagacatagcccgg
cggcgctctttagggaatatcaagtttattggggaattgttcaagctgaagatgttaaca
gaggcaataatgcatgactgtgtggttaaactacttaagaaccatgacgaagagtccctt
gaatgtctttgccgtctgctcaccaccattggcaaagacctggactttgaaaaagccaag
ccccgaatggatcagtatttcaaccaaatggaaaaaatcattaaagaaaagaagacttca
tcccgaatccgctttatgctgcaagacgtgctggatctgcgacggagcaattgggtgcct
cgccgaggggaccagggtcctaagaccattgaccagatccacaaggaggcggagatggag
gagcatcgggagcacataaaagtgcagcagctaatggccaagggcagcgacaaacgtcgg
ggtggccctccaggcccacccatcaaccgtggccttccacttgtggatgatggtggctgg
aacacagtccccatcagtaagggcagccgccctattgacacctcacgacttaccaagatc
acgaagcctggctccattgattctaacaaccaactcttcgcacctggagggcgattgagc
tggggcaagggtagcagtggaggctcaggagccaagccctccgatgcagcatcagaagct
gctcgtccagctactagtaccttgaatcgcttctcagcccttcaacaagcagcgcctaca
gaaagcacagaaaacaggcgtgtggcccagaggagtagcttgagccgtgaacgaggtgag
aaagctggagaccggggagaccgtctagagcggagtgaacggggaggcgaccgtggggac
cggctcgatcgctctcggacacctgcaaccaagcggagcttcagcaaggaagtggaggaa
cggagtagagagcggccctcccagcctgaggggctgcgcaaggcagctagcctgtcagag
gatcgggaccgcgggagggatgctgtgaagcgagaagccaccctgccccccgtgagtccc
ccaaagtctgtgctctctgaggaggaactggagaagaaatccaaggccatcattgaggaa
tatctgcatctcaatgacatgaaggaggcagtgcagtgtgtgcaggagctggcctcgcct
tccctgctcttcatctttgtgcggcatggcattgagtccacactggagcgcagcgccatt
gctcgcgaacatatgggacggctgctgcaccagctgctctgtgctggccacctctccact
gctcagtactaccaggggctgtatgaaatcctagaattggctgaagacatggaaattgat
atcccccatgtgtggctgtacctagcggaactagtaacaccaattctgcaggacagtggg
gtgcccatgggggagctgttcagggagattacaaaacctctgaggcccctgggcaaagct
gcttgcctattgctggagatcctgagactcctgtgcaaaaacatgggtcccaaaaaggtg
ggagcattgtggcaagaggctggactcagctggaaggaatttctacctgaaggccaagat
gttggcgcatttgtcgctgaacagaaggtggaatataccctaggagaggagtcagaagtc
ccaggccagaggttgctctcctcagaggagctgagcaggcagctggagaagctgctcaag
gagggcagcagtaatcagcggatatttgactggatagaggctaacctgagtgagcagcag
agagcatccaacacattagttcgagccctcatgaaaactgtttgctcttctgcaattatc
tttgagactcccctccgagtggatgttgcggagacttccctccgagtggacgttgaggtg
ctgaaagtgcgagcaaaactgctacagaaatacctttgtgacgagcagaaggagctgcag
gcactctatgccctccaggcccttgtagtgaccttagaacagcctcccaacctgcttcgg
ctgttctttgacgtgctatatgatgaggacgtggtaaaggaagatgccttctacagctgg
gagagtagcaaggacccagctgagcagcagggcaagggcgtggcccttaaatctgtcaca
aacttctttacatggcttcgtgaggaggaggaggagtctgaccacaactga

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107512124
Entry
107512124         CDS       T06036                                 

Gene name
EIF4G2
Definition
(RefSeq) eukaryotic translation initiation factor 4 gamma 2
  KO
K03260  translation initiation factor 4G
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray03013  RNA transport
ray05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:ray00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    107512124 (EIF4G2)
 09160 Human Diseases
  09166 Cardiovascular disease
   05416 Viral myocarditis
    107512124 (EIF4G2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:ray03019]
    107512124 (EIF4G2)
   03012 Translation factors [BR:ray03012]
    107512124 (EIF4G2)
Messenger RNA biogenesis [BR:ray03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     107512124 (EIF4G2)
   mRNA cycle factors
    Stress granule specific factors
     107512124 (EIF4G2)
Translation factors [BR:ray03012]
 Eukaryotic type
  Initiation factors
   eIF-4
    107512124 (EIF4G2)
SSDB
Motif
Pfam: MIF4G W2 MA3
Other DBs
NCBI-GeneID: 107512124
NCBI-ProteinID: XP_016002807
LinkDB
Position
Unknown
AA seq 1090 aa
MAIDRPPAAEAEYLETNSDSRRCTPGAPGLNPAGTSQGSPACGGNHRFMSAQFPLRHQLG
RSAFANTALRTAAGLRRNRAWPCGSPPALRGLVAGSSQAADWVQRVGALWRWRRVSGGGC
SSDSSELRVSSRSRLLPPPSLPLFCFPFPFPSLPRPRRPDPEEAAAVAAAEFSVKILRCQ
AAKVESAIAEGGASRFSASSGGGGSRGAPQHYPKTAGNSEFLGKTPGQNAQKWIPARSTR
RDDNSAANNSANEKERHDAIFRKVRGILNKLTPEKFDKLCLELLNVGVESKLILKGVILL
IVDKALEEPKYSSLYAQLCLRLAEDAPNFDGPAAEGQPGQKQSTTFRRLLISKLQDEFEN
RTRNVDVYDKRENPLLPEEEEQRAIAKIKMLGNIKFIGELGKLDLIHESILHKCIKTLLE
KKKRVQLKDMGEDLECLCQIMRTVGPRLDHERAKSLMDQYFARMCSLMLSKELPARIRFL
LQDTVELREHHWVPRKAFLDNGPKTINQIRQDAVKDLGVFIPAPMAQGMRSDFFLEGPFM
PPRMKMDRDPLGGLADMFGQMPGSGIGTGPGVIQDRFSPTMGRHRSNQLFNGHGGHIMPP
TQSQFGEMGGKFMKSQGLSQLYHNQSQGLLSQLQGQSKDMPPRFSKKGQLNADEISLRPA
QSFLMNKNQVPKLQPQITMIPPSAQPPRTQTPPLGQTPQLGLKTNPPLIQEKPAKTSKKP
PPSKEELLKLTETVVTEYLNSGNANEAVNGVREMRAPKHFLPEMLSKVIILSLDRSDEDK
EKASSLISLLKQEGIATSDNFMQAFLNVLDQCPKLEVDIPLVKSYLAQFAARAIISELVS
ISELAQPLESGTHFPLFLLCLQQLAKLQDREWLTELFQQSKVNMQKMLPEIDQNKDRMLE
ILEGKGLSFLFPLLKLEKELLKQIKLDPSPQTIYKWIKDNISPKLHVDKGFVNILMTSFL
QYISSEVNPPSDETDSSSAPSKEQLEQEKQLLLSFKPVMQKFLHDHVDLQVSALYALQVH
CYNSNFPKGMLLRFFVHFYDMEIIEEEAFLAWKEDITQEFPGKGKALFQVNQWLTWLETA
EEEESEEEAD
NT seq 3273 nt   +upstreamnt  +downstreamnt
atggctatagatcggccccctgcggccgaagcggagtacctggagaccaacagtgattcc
aggcgctgcaccccgggggcgccaggcctcaatcctgcaggcacgtcccagggaagcccg
gcctgcgggggcaatcaccgcttcatgagtgctcagttccccttacgccaccagctcggc
cggagcgccttcgcgaatacggctttgcgcactgcggcggggctgcgccgcaaccgagct
tggccctgtggctccccccccgccctgcgcggattggtggcggggagcagccaggctgct
gattgggtgcagcgagtcggagctctatggaggtggcggcgagtatcgggtggtggctgc
agcagcgactcctctgaactgagagtttcgagccgttcccgactccttcctcccccttcc
ctcccccttttttgttttccgttccccttcccctcccttccccgtccccgacgaccggat
cctgaggaggcagctgcggtggcagctgctgagttctcggtgaagattcttcgttgtcaa
gccgccaaagtggagagtgcgattgcagaagggggtgcttctcgtttcagtgcttcttcg
ggcggaggaggaagtaggggtgcacctcagcactatcccaagactgctggcaacagcgag
ttcctggggaaaaccccagggcaaaacgctcagaaatggattcctgcacgaagcactaga
cgagatgacaactccgcagcaaacaactccgcaaatgaaaaagaacgacatgatgcaatc
ttcaggaaagtaagaggcatactaaataagcttactcctgaaaagtttgacaagctatgc
cttgagctcctcaatgtgggtgtagagtctaaactcatccttaaaggggtcatactgctg
attgtggacaaagccctagaagagccgaagtatagctcactgtatgctcaactatgtctg
cgattggcagaagatgcaccaaactttgatggcccagcagcagagggtcaaccgggacag
aagcaaagcacaacattcagacgcctcctaatttccaaattacaagatgaatttgaaaac
cgaaccagaaatgttgatgtctatgataagcgtgaaaatcccctcctccccgaggaggag
gaacagagagccattgctaagatcaagatgttggggaacatcaaattcattggagaactt
ggaaagcttgatcttattcatgaatctatccttcataagtgcatcaaaacacttttggaa
aagaagaagagagtccaactcaaagatatgggagaggatttggagtgcctctgtcagata
atgaggacagtgggacctagattagaccatgaacgagccaagtccttaatggatcagtac
tttgcccgaatgtgttccttgatgttaagtaaggaattgccagccaggattcgtttcctg
ctgcaggataccgtagagttgcgagaacaccattgggttcctcgcaaggcttttcttgac
aatggaccaaagacgatcaatcaaatccgtcaagatgcagtaaaagatctgggagtgttt
attccagctcctatggctcaagggatgagaagtgacttctttctggagggaccgttcatg
ccacccaggatgaaaatggatagggacccacttggaggacttgccgatatgtttggacaa
atgccaggtagcggaattggtactggtccaggagttatccaggatagattttcacccacc
atggggcgtcatcgttcaaatcaactcttcaatggccatgggggacacataatgcctccc
acacaatcgcagtttggagagatgggaggcaagtttatgaaaagccaggggctaagccag
ctctaccataaccagagtcagggactcttatcccagctgcaaggacagtcgaaggatatg
ccacctcggttttctaagaaaggacagcttaatgcagatgagattagcctgaggcctgct
cagtcgttcctaatgaataaaaatcaagtgccaaagcttcagcctcagataactatgatt
cctcctagtgcgcaaccaccacgcactcagacaccacctctgggacagacacctcagctt
ggtctcaaaactaacccaccacttattcaggaaaagcctgccaagaccagtaaaaagcca
cccccatcaaaggaagaactactcaaactaactgaaactgttgtgactgaatatctcaat
agtggaaatgcaaatgaagctgtcaacggtgtgcgagaaatgagggctcctaaacacttt
cttcctgagatgttaagcaaagtaatcatcttgtcactagacagaagtgatgaagataaa
gaaaaagcaagttctttgatcagtttactcaaacaggaagggatagccacaagtgacaac
ttcatgcaggctttcctgaatgtactggaccagtgccccaaactagaggtcgacatcccc
ttggtgaaatcatatttagcacagtttgcagctcgtgccatcatttcagagctggtgagc
atttcagaactagctcaaccactggaaagtggcacccattttcctctcttcttactttgt
cttcagcaattagctaaattacaagatcgagaatggttaacagaactttttcaacaaagc
aaggtcaatatgcagaaaatgctcccagaaattgatcagaataaggatcgcatgttggag
attttggaaggaaagggactgagtttcttattcccactcctcaaattggagaaggaactg
ttgaagcaaataaagttggatccatcccctcaaaccatatataaatggattaaagataac
atctctcccaaacttcatgtagataaaggatttgtgaacatcttaatgactagcttctta
cagtatatttctagtgaagtaaacccacccagtgatgaaacagattcttcctctgctcct
tccaaagaacagttagagcaggaaaaacaactgcttctttctttcaagccagtaatgcag
aaattccttcacgatcatgttgatctacaagtcagtgccctatatgctcttcaggtgcac
tgctacaacagcaacttcccaaaaggcatgttactccgcttttttgttcacttctatgac
atggaaattattgaagaagaagctttcttagcttggaaagaagatataacccaagagttt
ccggggaaaggcaaggctttgttccaggtgaatcagtggctaacctggctagaaactgct
gaagaagaagaatcagaggaagaagctgactaa

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107513047
Entry
107513047         CDS       T06036                                 

Gene name
EIF4G3
Definition
(RefSeq) eukaryotic translation initiation factor 4 gamma 3 isoform X1
  KO
K03260  translation initiation factor 4G
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray03013  RNA transport
ray05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:ray00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    107513047 (EIF4G3)
 09160 Human Diseases
  09166 Cardiovascular disease
   05416 Viral myocarditis
    107513047 (EIF4G3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:ray03019]
    107513047 (EIF4G3)
   03012 Translation factors [BR:ray03012]
    107513047 (EIF4G3)
Messenger RNA biogenesis [BR:ray03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     107513047 (EIF4G3)
   mRNA cycle factors
    Stress granule specific factors
     107513047 (EIF4G3)
Translation factors [BR:ray03012]
 Eukaryotic type
  Initiation factors
   eIF-4
    107513047 (EIF4G3)
SSDB
Motif
Pfam: MIF4G MA3 W2 PP_kinase
Other DBs
NCBI-GeneID: 107513047
NCBI-ProteinID: XP_016004691
LinkDB
Position
Unknown
AA seq 1693 aa
MNSQPQTRSPILVLPRGWRNHSKEPSRTVPIHCTDNWKRRKVLEQTPVYRSLAGRGWIKY
CIFAAGPRPAHHQGGFRPIQFFQRPQIQPPRATIPNSSPSIRPGAQTPTAVYQANQHIMM
VNHLTMPYPVPQGPQYCIPQYRHSGPPYVGPPQQYPVQPPGPGPFYPGPGPGDFPNAYGT
PFYPSQPVYQSAPIIVPTQQQPPPAKREKKTIRIRDPNQGGKDITEEIMSGGGSRNPTPP
IGRPTSTPTPPQQLPSQVPEHSPVVYGTVESAHLAASTPVTAASDQKQEEKPKPDPVLKS
PSPVLRLVLSGEKKEQVGQMSETTAAESIPELPLPPSPTAISPIARSTIASPTTAARSSQ
PTFTTALDDRCELSSAKEDTVPIPSPTSCTETSDPSQTDVIDDDICKKSCSVAPNDIPLI
SSTNLINEMNGVSEKLPATESIVELVKQEVLPLTLELEILENPPEEMKVECVSAPITPST
VPSFSPSPPTPPASPPPVPVIVPAAAMNVSTASAPATVQRVSEEDESIRTCLSEDAKEIQ
NKIEVEADGQTEETLDSQNLSSRKSPVLAQTAITAPKMWKKPKDRTRTTEEVLETELEPK
AEEELSGDRVLESEQDKMSQGFHPERDSSDLKKVKAVEENGEEAEPVHNGAESVSEGEAV
DANSGYTDSSGEGVTFSFKPESWKPADTEGKKQYDREFLLDFQFMPACIQKPEGLPPITD
VVLDKINQPKLPMRTLDPRILPRGPDFTPAFADFGRQTPGGRGVPICKVQSRHGLPILEQ
SKAPICTSLAMSHPPLKSLPLGLSNVGPRRSQPGQRREPRKIITVPVKEDVHLKKAENAW
KPSQKRDSQAEDPENIKTQELFRKVRSILNKLTPQMFNQLMKQVSGLTVDTEERLKGVID
LVFEKAIDEPSFSVAYANMCRCLVTLKVPMADKPGNTVNFRKLLLNRCQKEFEKDKADDD
VFEKKQKELEAASAPEERTRLHDELEEAKDKARRRSIGNIKFIGELFKLKMLTEAIMHDC
VVKLLKNHDEESLECLCRLLTTIGKDLDFEKAKPRMDQYFNQMEKIVKERKTSSRIRFML
QDVIDLRLCNWVSRRADQGPKTIEQIHKEAKIEEQEEQRKVQQLMTKEKRRPGVQRVDEG
GWNTVQGAKNSRVLDPSKFLKITKPTIDEKIQLVPKAQLGSWGKGSSGGAKASETDALRS
SASSLNRFSALQPPAPSGSTSSTPLEFDSRRTLTSRGSMGREKNDKPLPSAAARANTFMR
GSSSKDLLDNQSQEEQRREMLETVKQLTGGMDVDRNSAEADRNKTRESVAKPEIPATSAP
DKPTLSEEEMERKSRSIIDEFLHINDFKEAMQCVEELNAQGLLHVFVRTGVESTLERSQI
TRDHMGQLLYQLVQSEKLSKQDFFKGFSETLELADDMAIDIPHIWLYLAELVTPMLKEGG
ISMRELIIEFSKPLLPVGRAGVLLSEILHLLCKQMSHKKVGALWREADLSWKDFLPEGED
VHNFLLEQKLDFIESDSSCSSEALSKKELSAEELYKRLEQLIIEDKANDEQIFDWVEANL
DESQMSSPTFLRALMTAVCKAAIIADCSTFRVDTAVIKQRVPILLKYLDSDTEKELQALY
ALQASIVKLDQPANLLRMFFDCLYDEEVISEDAFYKWESSKDPAEQNGKGVALKSVTAFF
TWLREAEEESEDN
NT seq 5082 nt   +upstreamnt  +downstreamnt
atgaattcacaacctcaaacccgttctccgatcctggttctccccagggggtggaggaac
cattctaaagagcccagcagaacagtgccaatacattgcacagacaactggaagaggagg
aaggttttggaacagactcccgtttacaggtccttggctggaagaggctggataaaatac
tgcatttttgcagcggggcctcgacctgcccatcatcagggaggattcagacccatccag
tttttccagaggcctcaaatacagcctcctagagctaccatcccgaacagcagtccttct
attcgtcctggtgcacagacacccactgcagtgtatcaggccaatcagcacatcatgatg
gttaaccatcttaccatgccgtacccagtaccccagggtcctcagtactgtataccacag
taccgtcatagtggccctccatatgtcggacccccacaacagtatccagttcaaccacca
gggccaggtcctttttatcctggaccaggacctggagacttccctaatgcttacggaacg
cctttttacccaagtcagccagtgtatcagtcagcacctatcatagtgcctacgcagcag
cagccccctccagccaagagagagaaaaaaacaataagaattcgggatccaaaccagggg
ggtaaagacataacagaggagattatgtctggaggtggtagcagaaatcccactccaccc
atagggagacccacatccacacctactcctcctcagcagctgcccagccaggtccccgag
cacagccctgtggtttatgggactgtggagagcgctcatcttgctgccagcacccctgtc
actgcagctagcgaccagaagcaagaggagaagccaaaaccagacccagtgttaaagtct
ccttccccagtgcttaggttagtccttagtggagagaagaaagaacaagtgggccagatg
tctgagactactgcagcagaatccataccagagcttcctctgcctccatcaccaaccgct
atttctccaattgctcgaagtacaattgcttcccccaccactgctgctcgcagtagccag
ccgacattcaccactgctctagacgacagatgtgaactctcctccgcaaaagaagacaca
gttcctatacccagccccacatcttgcacagaaacatcagatccttcacaaacagatgtt
atcgatgatgatatatgcaagaaatcttgtagtgtagcacctaatgatattccactgatt
tctagtactaacctaattaatgaaatgaatggagttagtgaaaaattaccagccacagag
agcattgtggaattggtaaaacaggaggtgttgccattgactcttgaattggagattctg
gaaaatcccccagaagaaatgaaagtggagtgtgtttcagctcccatcaccccttccaca
gttccttccttttctccatctcctccaactcctccagcttctcctcctcccgtgccagtc
atcgtccctgctgccgccatgaacgttagtactgctagtgctcccgccacagtccagaga
gtctcagaagaggatgagagtataagaacttgcctcagtgaagatgcgaaagagattcag
aacaaaatagaggtagaagcagatgggcaaacagaagagactttggattctcagaactta
agttcaaggaagagccctgtcctagctcagacagctataactgcaccaaagatgtggaag
aaaccaaaagatcggacccgaaccactgaagaggtgttagaaacagaattggagcctaaa
gctgaagaggagctttcaggtgacagagtacttgaatctgaacaggataaaatgagccaa
gggtttcatcctgaaagagactcctcagatctaaaaaaagtgaaagctgtggaagaaaat
ggagaagaagctgagcctgtacataatggtgctgagagtgtttctgagggtgaagcagta
gatgctaattcaggctacactgatagttctggtgaaggggtcacattctcatttaaacca
gaatcctggaagcctgctgatactgaaggcaagaagcagtatgacagggagtttttattg
gactttcagttcatgccagcctgtatacagaaaccagagggcctgcctcccatcactgat
gtggttcttgacaagatcaaccagcccaaattgccaatgcgaactctggatcctcggatt
ttgcctcgaggaccagattttactccagcctttgcagattttggaaggcaaactcctggt
ggtagaggtgtacctatttgcaaagtacagagcaggcatggattgccaattctggaacag
agcaaagccccaatttgcacctcactggcgatgtcgcacccgcccctgaagagcctgcct
ctagggttgtcgaacgttggaccacggagatctcaacctggccagaggagagagcccagg
aagatcatcacagtccctgtaaaagaggacgtgcacctgaaaaaggcagagaacgcctgg
aagcccagccaaaaacgagacagccaggctgaggatcccgaaaacattaagacccaggaa
ctttttagaaaagttcgaagtatcttaaataagttgacaccacagatgtttaaccagctg
atgaagcaagtgtcaggtctcactgttgacacagaggagcggctgaaaggagtcattgac
ctggtctttgagaaggctattgatgaacccagtttctctgtggcttacgcaaacatgtgt
cgatgtctagtaacgctgaaagtacccatggcagacaagcctggaaacacagtgaatttc
cggaagctgctattgaaccgttgccagaaggagtttgaaaaagataaagcagatgatgat
gtctttgagaagaagcagaaagaactcgaggctgccagtgccccagaggagaggacgagg
cttcacgatgaactggaagaagctaaggacaaagcccggcggagatccattggtaacatc
aagtttattggagaactctttaaactgaaaatgctgacggaagctatcatgcatgactgt
gtggtgaagctgctgaagaaccatgatgaagaatccctggagtgcctgtgccgcctgctc
accaccattggcaaagacctcgattttgagaaagcaaagccacgtatggaccagtatttt
aatcagatggagaaaatcgtgaaagaaaggaaaacctcatctaggattcgattcatgctt
caggatgtgatagacctaagactgtgtaattgggtatctcgaagagcagatcaagggcct
aaaactattgaacagattcacaaagaggctaaaatagaagaacaagaagagcaaaggaag
gtccagcagctcatgaccaaagagaagagaagaccaggcgtccagagagtggatgaaggt
gggtggaacactgtacaaggggccaagaatagtcgggttctggacccctcaaaattcctg
aaaatcactaagcctacaattgatgagaaaatccagctggtacctaaagcacagctgggc
agttggggaaaaggcagcagtggtggagcaaaggcaagcgagactgatgccttaaggtca
agtgcttccagtttaaatagattctctgctttgcaacctccagcaccctcagggtctaca
tcatctacacctttagagtttgattcccgccggaccttaaccagtcgcggaagcatgggc
agggagaagaatgacaagcccctgccatctgcagcagctcgtgcaaacactttcatgagg
ggcagcagtagtaaagacctgttagacaatcagtctcaagaagagcaacggagagagatg
ctagagacggtgaaacagctcaccggaggcatggatgtggacaggaacagcgccgaggcg
gaccgaaacaagaccagggagtcagtagcaaaaccagaaattccagcaacatcagcccct
gacaagcctacattgtcagaagaggagatggagagaaagtccagatctatcattgatgaa
tttctacacattaatgattttaaggaagccatgcagtgtgtggaagagctgaacgcccag
ggtctgctacatgtgtttgtgagaacaggggtggagtccaccctggaaaggagccagatc
accagggatcacatgggccaattactgtatcagctggtgcagtcagaaaaactcagcaag
caggactttttcaaaggtttttcagaaacattggaattggcggatgacatggctattgat
attccccatatttggttgtaccttgctgaattggtgactcccatgttaaaagaaggtgga
atctccatgagagaacttatcatagaatttagcaaacctttacttcctgttggaagagct
ggggtcttgctttctgaaatattgcaccttctatgcaaacaaatgagccataagaaagtg
ggagccttatggagggaagctgacctcagctggaaggactttttaccagaaggggaagat
gtacataattttctcttggagcagaagttggactttatagagtctgacagttcctgttcc
tccgaagcactttcaaagaaagaactctctgctgaagagctatataagcgactcgagcaa
ctcatcattgaggacaaagcaaatgatgaacagatctttgactgggtagaggctaatcta
gatgaaagccagatgagttcacctacattccttagagctttaatgacagccgtttgtaaa
gcagctattatagctgactgttctacctttcgagtggacactgctgttattaagcagaga
gtaccgatcttactcaagtacctagactcggatacagagaaggaactgcaagcactttat
gcactacaagcatcaatagtaaaacttgatcaacctgctaatttgttacggatgtttttt
gattgcctgtatgatgaagaggtaatctccgaggatgccttctacaaatgggaaagcagc
aaagaccccgcagagcagaatgggaagggcgtggccctcaaatctgtcacggcattcttc
acatggcttcgagaagcagaagaggaatctgaggataactaa

DBGET integrated database retrieval system