KEGG   Rousettus aegyptiacus (Egyptian rousette): 107504944
Entry
107504944         CDS       T06036                                 

Gene name
NPPC
Definition
(RefSeq) C-type natriuretic peptide
  KO
K12336  natriuretic peptide C
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04022  cGMP-PKG signaling pathway
ray04270  Vascular smooth muscle contraction
ray05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04022 cGMP-PKG signaling pathway
    107504944 (NPPC)
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    107504944 (NPPC)
 09160 Human Diseases
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    107504944 (NPPC)
SSDB
Motif
Pfam: ANP
Other DBs
NCBI-GeneID: 107504944
NCBI-ProteinID: XP_015990096
LinkDB
Position
Unknown
AA seq 125 aa
MHLSQLLACVLLLMLLSLGPSESKPAAAPKVQRTPQGEELAVSQAEGGSQKKRDKTPGGG
GAHPKGDQSRLFRDLRVETKARVAWARHLQENPNARKNKGNKKGPNKGCFGLKLDRIGST
SGLGC
NT seq 378 nt   +upstreamnt  +downstreamnt
atgcacctctcccagctgctggcctgcgtcctgctgctcatgctactctcgctcgggccc
tccgagtccaagcccgcggcggcgccgaaggtccagcgaactccgcagggggaagagctg
gccgtgtcccaggctgagggcggcagtcagaagaagcgcgacaagactcccgggggcggc
ggcgcccaccccaagggcgaccagtcgcgactcttccgggacctacgagtagaaactaag
gctcgggtggcgtgggcccgccatctgcaagagaaccccaacgcgcgcaaaaacaaaggc
aacaagaagggcccgaacaagggctgcttcggcctcaagctggaccggatcggctccacc
agcggcctgggatgttga

DBGET integrated database retrieval system