KEGG   Rousettus aegyptiacus (Egyptian rousette): 107505337
Entry
107505337         CDS       T06036                                 

Gene name
CPEB1
Definition
(RefSeq) cytoplasmic polyadenylation element-binding protein 1 isoform X1
  KO
K02602  cytoplasmic polyadenylation element-binding protein
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04114  Oocyte meiosis
ray04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:ray00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    107505337 (CPEB1)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    107505337 (CPEB1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:ray03019]
    107505337 (CPEB1)
Messenger RNA biogenesis [BR:ray03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     107505337 (CPEB1)
   Factors involved in mRNA localization
    Trans-acting binding proteins
     107505337 (CPEB1)
   mRNA cycle factors
    P-body specific factors
     107505337 (CPEB1)
SSDB
Motif
Pfam: CEBP1_N RRM_7 CEBP_ZZ RRM_1
Other DBs
NCBI-GeneID: 107505337
NCBI-ProteinID: XP_015990884
LinkDB
Position
Unknown
AA seq 514 aa
MLFPTSAQDSPRGLPDANDLCLGLQSLSLTGWDRPWSTQDSDASAQSSTHSVLSMLHNPL
GSVLGKPPLSFLPLDPLGSDLVDKFPAPSVRGPRLDTRPMLDSRSSSPSDSDTSGFSSGS
DHLSDLISSLRISPPLPFLSLTGGGPRDSLKMGVGSRMDQEQVALAAAVTPSLTSASKRW
PGASVWPSWDLLEAPKDPFSIEREARLHRQAAAVNEATCTWSGQLPPRNYKNPVYSCKVF
LGGVPWDITEAGLVNTFRVFGSLSVEWPGKDGKHPRCPPKGNMPKGYVYLVFELEKSVRA
LLQACSHDPLSPDGLSEYYFKMSSRRLRCKEPTLLSRTSRLRNEIENSNFRSVVQVIPWV
LADSNFVRSPFQRFDPSRTVFVGALHGMLNAEALAAILNDLFGGVAYAGIDTDKHKYPIG
SGRVTFNNQRSYLKAVSAAFVEIKTTKFTKKVQIDPYLEDSLCHICSSQPGPFFCRDQVC
FKYFCRSCWHWQHSSEGLRHHSPLMRNQKNRDSS
NT seq 1545 nt   +upstreamnt  +downstreamnt
atgcttttccccacctctgcgcaagattctccccgtggcctcccagatgcaaatgacttg
tgccttggcctgcagtccctcagtctcacaggctgggaccgaccctggagcacccaggac
tcagatgcctcagcccagagcagcacacactcagtgctgagcatgctgcacaaccctttg
ggcagtgtcctagggaagccccccttgagcttcctgcctctggacccacttggatctgac
ttggtggacaagttcccagcaccctcagtgagaggaccccgcctggacacgcggcccatg
ctggattcccgttctagcagcccctctgactcagacaccagtggcttcagctctggatca
gatcatctctcagatttgatttcaagccttcgcatttccccccctctgcccttcctgtct
ctgacagggggtgggcccagagattctttaaagatgggggttgggtcccggatggaccaa
gagcaagtcgctctcgctgctgcagtcactccttccctaaccagtgcatcaaagagatgg
ccaggagcttctgtgtggccatcctgggacctcttggaagctcccaaagaccccttcagc
atagagagagaggccaggctgcacaggcaggctgcagctgtgaatgaagccacctgtacc
tggagtggccagcttcctccccggaactacaagaaccccgtctactcctgcaaggtgttc
ctcggaggcgtcccttgggatattacggaagctggcttggttaacaccttccgtgttttt
ggctctttgagtgtggagtggcctggtaaggatggcaagcaccctcggtgtcctcccaaa
ggtaatatgcctaaagggtacgtgtatctggtctttgagctcgagaagtctgtccgggcc
ttgctgcaggcgtgctctcacgaccctctgagcccagatggcctgagcgaatactatttc
aagatgtccagccgaaggttgcgctgcaaggagccaacacttctgtcccgaacatctcgt
cttagaaatgaaattgaaaacagcaacttccgatctgtggtacaagtgatcccctgggtc
ttggctgacagcaactttgtccggagcccatttcagagattcgaccccagcaggacggtg
tttgtgggtgctctgcatgggatgctcaatgccgaggccctggcagccattctgaacgac
ctgtttggtggagtggcgtacgccggcattgacacagataagcacaagtatcccattggg
tctggtcgcgtgactttcaataaccagcgtagttacctgaaagcagtcagtgctgctttt
gtggagatcaaaaccaccaagttcaccaagaaggttcagatcgacccatacctggaagat
tctctatgtcatatctgtagttctcagcctggtcctttcttctgtcgagatcaggtgtgc
ttcaagtatttctgccggagctgctggcactggcagcacagctcagagggcctgcgccac
cacagtcccctgatgcggaaccagaagaaccgagattccagctga

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107507335
Entry
107507335         CDS       T06036                                 

Gene name
CPEB2
Definition
(RefSeq) LOW QUALITY PROTEIN: cytoplasmic polyadenylation element-binding protein 2
  KO
K02602  cytoplasmic polyadenylation element-binding protein
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04114  Oocyte meiosis
ray04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:ray00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    107507335 (CPEB2)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    107507335 (CPEB2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:ray03019]
    107507335 (CPEB2)
Messenger RNA biogenesis [BR:ray03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     107507335 (CPEB2)
   Factors involved in mRNA localization
    Trans-acting binding proteins
     107507335 (CPEB2)
   mRNA cycle factors
    P-body specific factors
     107507335 (CPEB2)
SSDB
Motif
Pfam: RRM_7 CEBP_ZZ RRM_1
Other DBs
NCBI-GeneID: 107507335
NCBI-ProteinID: XP_015993885
LinkDB
Position
Unknown
AA seq 1004 aa
MRDVGLGVLQGARLRSGSPGPALGGGQHRAHAAAAAPLPPATPFGPRSPPPLPVTGFSQA
ASPCSVPLGRGGAGSSAAAASSSSPFPARQQTMQDERLLGLTQQPARPRSGAAAAEKVPS
RQAGGGANAGVTHLLPAPDSRPSLQHSAPAPASARCRRRAASPQDFSPRQQQQPSSQKRK
EFSPPRPPRPPDPPPPGPLRQPSPLSLPHTQHLPPQDFAPRQRPAELPPLPQLQPSPPAA
PRRRHGGAGSPRTTPAAGEGSAAEPPNAGLAASTPPVNPAPGPWSXPNHPLLSSPGTLLP
GAALGSGAFSSLQSADLPHPGGGGGGGGGGXPAGGGGGGSASPPLPGFGAPWSVQTASPP
PQSQQPPPPPQQPPPPPPPQPPQSQPPPPGSSAATTGGGGGGGSLSAMPXPSPDPENGFY
PGLPSSMNPAFFPSFSPVSAHGCAGLSVPAGGGGGGGGGGFGGPFSAAAVPPPPPPXSLP
QPQPPPXRAPQQPASRRSPVSPQLQQQHPAAAFLQQRNSYNHHQPLLKQSPWSNHQNSGW
GTGSMSWGAMHGRDHRRTGNMGIPGTMNQISPLKKPFSGNVIAPPKFTRSTPSLTPKSWI
EDNVFRTDNNSNTLLPLQVRSSLQLPAWGSDSLQDSWCTAAGTSRIDQDRSRMYDSLNMH
SLENSLIDIMRAEHDPLKGRLSYPHPGTDNLLMLNARSYGRRRGRSSLFPIDDGLLDDGH
NDQVGVLNSPTCYSAHQNGERIERFSRKVFVGGLPPDIDEDEITASFRRFGPLVVDWPHK
AESKSYFPPKGYAFLLFQEESSVQALIDACIEEDGKLYLCVSSPTIKDKPVQIRPWNLSD
SDFVMDGSQPLDPRKTIFVGGVPRPLRAVELAMIMDRLYGGVCYAGIDTDPELKYPKGAG
RVAFSNQQSYIAAISARFVQLQHGDIDKRVEVKPYVLDDQMCDECQGARCGGKFAPFFCA
NVTCLQYYCEFCWANIHSRAGREFHKPLVKEGADRPRQIHFRWN
NT seq 3015 nt   +upstreamnt  +downstreamnt
atgcgggacgtcgggctcggcgtgctgcagggcgcccggctccgaagcggcagccccggg
ccggcactcggcggcgggcagcaccgtgcgcacgccgcggccgccgccccgctgccgccc
gccacgcccttcggcccccgctcgccgccgccgttgcctgtcaccggcttctcgcaggcc
gcctccccctgctcggtccccctcggccgcggcggcgcgggcagctcggccgccgccgct
tcctcttcctccccgttcccagcgcgtcagcagaccatgcaggatgagcggctgctgggg
ctgacacagcagccggcgcggccgcgctcgggggcggcggccgcggagaaagtccccagc
cgccaggcgggcggcggcgcgaacgcgggtgtgacccacctcctccccgccccggactcc
cgaccgagtctgcagcactccgcccccgcccccgcctccgcccgctgccgccgccgcgcc
gcctccccgcaggacttcagtccgcggcagcagcagcagccgagcagccagaagaggaaa
gagttcagccctccccgccctccccgccctccggacccgccgccgcccggcccgctccgc
cagccgtcgccgctcagtctcccgcacacgcagcacctcccgccgcaggacttcgccccg
cggcagcgcccggccgagctgcccccgctcccgcagctccagccctcgccgcccgcagcc
ccgcggcgccgccacggaggcgcgggcagcccccgcacgaccccggccgcgggcgagggc
agcgccgccgagccccccaatgcgggcttggccgcctcgacgccgccggtgaaccccgcg
ccgggcccatggagtnnccccaaccaccctctgctcagcagtcccggaaccctcctgccc
ggcgcggcgctcggctcgggcgccttcagcagcctccagagcgcggacctcccgcacccg
ggcggcggcggcggcggcggcggcggcgggngccccgcaggcggagggggaggcggctcc
gcgtcgccgccgctgcccggcttcggcgccccctggtcagtgcagaccgcgtcgccgccg
ccccagtcccagcagccgccgccgccgccgcagcagccgccgccgccgccgccgccgcag
ccgccgcagtcgcagccgccgccgcccggctcgtcggccgccaccacgggcggcggcggc
ggcggcggctcgctcagcgccatgccgncgcccagccccgacccggagaacggcttctac
ccggggctgccgtcgtccatgaacccggccttcttcccgagcttctcgcccgtgtccgcg
cacggctgcgcggggctcagcgtgccggccggcggcggcggcggcggcggcggcggcggc
ttcggcggccccttctcggcggccgcggtgcccccgccgccgccgcccntgagtttacct
cagccgcagccgccgccgngccgcgcgccgcagcagcccgccagccggaggtcgcccgtc
agcccgcagctccagcagcagcacccggcggccgccttcctgcagcagcggaactcgtac
aaccaccaccagcctcttctgaaacaatctccttggagcaaccatcagaacagtggctgg
ggcactggaagtatgtcgtggggagcaatgcatggcagagatcaccgtagaactggaaac
atgggaattccaggaactatgaatcaaatatctccattgaagaaaccgttttctggtaat
gtcatagcaccaccgaaatttactcgctctactccatcactgactccaaaatcttggatt
gaagataatgtgttcagaacagacaacaatagtaacacactcttacccttacaggtgaga
tctagtttgcagttgccagcttggggctcagattcactccaagatagttggtgcactgca
gccggaacatccagaatagaccaggatcgaagtagaatgtatgacagtttgaatatgcac
tctttggaaaattcccttattgatattatgagagcagagcatgatcctcttaagggtcga
ttgagctatccacatccaggaactgacaatctgttgatgttaaatgcaaggagttatggg
cgaagacgaggtcgttcttccctctttccaatagatgatggcttgctggatgatggtcac
aatgatcaagttggtgttttaaactcacccacatgttactcagctcatcaaaacggagag
cgaattgaacgcttctctcgaaaagtttttgttggtggtcttcctccagatattgatgaa
gatgaaataactgctagcttcagaagatttgggcctttggtagtagattggcctcataaa
gcagaaagcaagtcctattttccaccaaaaggctatgcattccttctctttcaagaagag
agctcagttcaggcactaattgatgcttgtattgaagaagatggaaaactctatctctgt
gtttccagccctaccatcaaagacaaaccagttcagattcgtccttggaatttaagtgat
agtgattttgtgatggatggttctcagcctctggatcctcgaaaaacaatttttgttgga
ggtgttcctaggccattaagggctgtggaacttgctatgatcatggaccggctgtatggt
ggagtgtgttatgcgggaattgatacagatcctgagctgaaatacccgaaaggtgctggc
cgagtcgctttctccaatcagcagagctacatcgctgccatcagcgcgcgcttcgtccag
ctccagcacggcgacattgataagcgtgtggaggtgaagccatatgtgctggatgaccag
atgtgtgatgagtgccagggcgcgcgctgtggtgggaaatttgccccctttttctgtgcc
aacgtcacctgcctgcagtattactgtgagttctgctgggcaaacatccactcgcgtgca
gggcgtgagttccataagccattggtaaaggaaggcgccgaccgcccacgtcagatccac
ttccgctggaactag

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107511045
Entry
107511045         CDS       T06036                                 

Gene name
CPEB4
Definition
(RefSeq) cytoplasmic polyadenylation element-binding protein 4 isoform X1
  KO
K02602  cytoplasmic polyadenylation element-binding protein
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04114  Oocyte meiosis
ray04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:ray00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    107511045 (CPEB4)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    107511045 (CPEB4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:ray03019]
    107511045 (CPEB4)
Messenger RNA biogenesis [BR:ray03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     107511045 (CPEB4)
   Factors involved in mRNA localization
    Trans-acting binding proteins
     107511045 (CPEB4)
   mRNA cycle factors
    P-body specific factors
     107511045 (CPEB4)
SSDB
Motif
Pfam: RRM_7 CEBP_ZZ RRM_1 zf-U1
Other DBs
NCBI-GeneID: 107511045
NCBI-ProteinID: XP_016000599
LinkDB
Position
Unknown
AA seq 729 aa
MGDYGFGVLVQSNTGNKSAFPVRFHPHLQPPHHHQNATPSPAAFINNNTAANGSSAGSAW
LFPAPATHNIQDEILGSEKAKSQQQEQQDPLEKQQLSPSPGQEAGILPETEKAKAEENQG
DNSSENGSGKEKIRIESPVLTGFDYQEAAGLGTSTQPLTSSASSLTGFSNWSAAIAPSSS
TIINEDASFFHQGGVPAASANNGALLFQNFPHHVSPGFGGSFSPQIGPLSQHHPHHPHFQ
HHHSQHQQQRRSPASPHPPPFTHRNAAFNQLPHLANNLNKPPSPWSSYQSPSPTPSSSWS
PGGGGYGGWGGSQGRDHRRGLNGGITPLNSISPLKKNFASNHIQLQKYARPSSAFAPKSW
MEDSLNRADNIFPFPDRPRTFDMHSLESSLIDIMRAENDSIKGRLNYSYPGSDSSLLINA
RTYGRRRGQSSLFPMEDGFLDDGRGEQPLHSGLGSPHCFTHQNGERVERYSRKVFVGGLP
PDIDEDEITASFRRFGPLIVDWPHKAESKSYFPPKGYAFLLFQDESSVQALIDACIEEDG
KLYLCVSSPTIKDKPVQIRPWNLSDSDFVMDGSQPLDPRKTIFVGGVPRPLRAVELAMIM
DRLYGGVCYAGIDTDPELKYPKGAGRVAFSNQQSYIAAISARFVQLQHGEIDKRVEVKPY
VLDDQLCDECQGARCGGKFAPFFCANVTCLQYYCEYCWAAIHSRAGREFHKPLVKEGGDR
PRHISFRWN
NT seq 2190 nt   +upstreamnt  +downstreamnt
atgggggattacgggtttggagtgctagtgcaaagcaatactgggaataaatctgctttt
ccagtccgattccatccacatctgcagcctccgcaccatcaccaaaatgccacccccagc
cctgccgctttcataaataataacacagctgccaacggcagcagtgccgggtcagcttgg
ctctttcctgctccggccacccacaacattcaggatgagatcctggggtcagaaaaagca
aaaagtcagcaacaggaacagcaagaccctttggaaaagcagcagctgtccccgagtccc
gggcaggaagccggaatcctgcctgaaaccgagaaggcaaaagccgaagaaaatcagggg
gacaactcttcagaaaatggcagcgggaaggagaaaatcagaatcgaatcgccagtgttg
acggggtttgattatcaagaagccgcggggctcggtacttccactcaacccttgacatcc
agtgcatcgtctcttactggtttcagtaactggtcagcggccatcgcgccttcttcgtct
acaatcatcaacgaagatgccagtttctttcaccagggaggggtcccggctgcttcggct
aataacggtgctctgttgtttcaaaattttccccatcatgtcagccctggcttcggaggc
agcttctcccctcagatcgggcctctgtcacagcaccaccctcatcaccctcatttccag
catcatcacagccagcatcagcagcaaaggaggtctcctgccagtccccaccccccacct
ttcacacatagaaatgctgcttttaaccagctgcctcatttggcgaataatcttaacaaa
cccccctctccatggagcagctaccagagtccctctcctactccctcttcttcctggagc
ccgggaggtggcggatatggtggctggggaggttcccaaggccgtgatcaccgcagaggg
ctgaatggaggaataacacccctgaattccatctcgcctttgaagaagaattttgcaagc
aatcatattcagctccagaagtatgctcgccccagctctgcctttgctcctaagtcctgg
atggaagacagcttgaacagggctgacaacatttttccttttccggaccgccccaggaca
tttgacatgcactccctggagagttcactcattgacataatgagagccgaaaacgattcg
attaaaggtcgtctaaactattcatatccaggatccgatagctctctgcttattaatgca
aggacatatgggcgaaggagaggtcagtcttcactgtttccaatggaagatggattcttg
gatgatggccgtggggagcaacctctacacagcggcctgggctcgcctcactgcttcact
caccagaatggagaaagagtggaacgctattctcgcaaggtgttcgtgggcgggttgcct
cccgacatcgacgaagatgaaatcacagctagttttcgtcgctttggccccttgattgtg
gactggcctcataaagcagagagcaaatcctattttcctcctaaaggctatgcatttctg
ctgtttcaagatgagagctctgtgcaggcgctcatcgacgcatgcattgaagaagatgga
aaactctacctgtgtgtgtcgagccccaccatcaaagataagccagtacagattcggcct
tggaatctcagtgacagtgacttcgtgatggacggttcacagcctctcgacccacgaaaa
actatattcgttggtggtgttcctcgaccgttacgagctgtggagcttgccatgatcatg
gatcgcctgtacggaggtgtgtgctacgccggcatcgacactgaccccgagctgaagtac
cccaagggcgccgggcgggtcgccttctccaatcaacagagttacatagctgctatcagt
gcccgctttgttcagctgcagcacggagagatagataaacgggtggaagtgaagccatat
gtcttggatgatcagctgtgtgacgaatgtcagggggcccgttgcgggggcaaattcgct
ccgtttttctgtgctaacgttacctgtctgcagtattactgtgagtattgctgggctgct
attcactctcgtgccggcagggagttccacaagcccctggtgaaggaaggtggcgaccgt
cctcgacatatttcattccgctggaactga

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107514004
Entry
107514004         CDS       T06036                                 

Gene name
CPEB3
Definition
(RefSeq) LOW QUALITY PROTEIN: cytoplasmic polyadenylation element-binding protein 3
  KO
K02602  cytoplasmic polyadenylation element-binding protein
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04114  Oocyte meiosis
ray04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:ray00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    107514004 (CPEB3)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    107514004 (CPEB3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:ray03019]
    107514004 (CPEB3)
Messenger RNA biogenesis [BR:ray03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     107514004 (CPEB3)
   Factors involved in mRNA localization
    Trans-acting binding proteins
     107514004 (CPEB3)
   mRNA cycle factors
    P-body specific factors
     107514004 (CPEB3)
SSDB
Motif
Pfam: RRM_7 CEBP_ZZ RRM_1 zf-U1 zf-B_box
Other DBs
NCBI-GeneID: 107514004
NCBI-ProteinID: XP_016006777
LinkDB
Position
Unknown
AA seq 724 aa
MQDDLLMDKSKSQPQPQQQRQQQQQQKQQQQQQQQQQQQPSAAEAPSTPLSSETPKPEDS
SAVPALSPAAAPPAPNGPDKMQMESPLLPGLSFHQPPQQPPPPPQEPAAPGASLSPSFGS
TWSTATTNAVEDSFFQGITPVNGTMLFQNFPHHVNPVFGGTFSPQIGLAQTQHHQQPPPP
APQPAQPAQPPQAQPPQQRRSPASPSQAPYAQRSAAAAYGHQPIMTSKPSSSSAAAAAAA
AAAASSASSSWNTHQSVNAAWSAPSNPWGGLQAGRDPRRAVGVGVGVGVGVPSPLNPISP
LKKPFSSNVIAPPKFPRAAPLTSKSWMEDNAFRTDNGNNLLPFQDRSRPYDTFNLHSLEN
SLMDMIRTDHEPLKGKHYPPSGPPMSFADIMWRNHFAGRMGINFHHPGTDNIMALNTRSY
GRRRGRSSLFPFEDAFLDDSHGDQSLSSGLSSPTRCQNGERVERYSRKVFVGGLPPDIDE
DEITASFRRFGPLVVDWPHKAESKSYFPPKGYAFLLFQEESSVQALIDACLEEDGKLYLC
VSSPTIKDKPVQIRPWNLSDSDFVMDGSQPLDPRKTIFVGGVPRPLRAVELAMIMDRLYG
GVCYAGIDTDPELKYPKGAGRVAFSNQQSYIAAISARFVQLQHNDIDKRVEVKPYVLDDQ
MCDECQGTRCGGKFAPFFCANVTCLQYYCEYCWASIHSRAGREFHKPLVKEGGDRPRHVP
FRWS
NT seq 2175 nt   +upstreamnt  +downstreamnt
atgcaggatgatttactgatggacaaaagcaaaagccagccccagccccagcagcagcgg
cagcagcagcagcagcagaagcagcagcagcagcagcagcagcagcagcagcagcagccc
agcgcagccgaagccccgtccacgcccctctcttcagagacccccaagccggaggacagc
agtgcagtgccggctctcagccccgccgcggccccgccggcccccaacggcccagacaag
atgcagatggaatcgccgctcctgccgggcttgagtttccaccagccccctcagcagccg
ccgccgccaccgcaggagcccgcggcgccgggtgcgtcgctgtcgccgtccttcggcagc
acctggtccacggccaccacaaacgctgtggaggacagcttctttcaggggatcacccca
gtcaacgggaccatgctcttccagaacttcccgcatcacgtcaacccagtcttcggaggc
accttctccccgcagatcggcctggcgcagacccagcaccaccagcagccgccgccaccc
gcgccgcagcccgcgcagcccgcgcagccccctcaggcgcagcccccgcagcagcgcagg
tcgcccgccagccccagccaggcgccctacgcacagagaagcgccgctgcggcttacggc
caccagcccatcatgaccagcaagccgtcctcgtcctcggctgcagcagctgctgcggcc
gcggcggccgcctcgtctgcctcgtccagctggaatacgcaccagagtgtgaacgccgcc
tggagcgcgccgtccaatccgtggggcggcctgcaggcgggtcgggaccctcgccgggcg
gtcggtgtaggagtgggcgtgggcgtcggggtaccttcaccactcaaccccatttcaccg
ctcaaaaagcccttctccagcaatgtgatcgcaccacccaagttcccccgcgcggccccg
cttacctccaagtcctggatggaggataacgctttccggaccgataatggtaacaatctg
ttgccatttcaggaccggagtaggccctatgacacttttaacttgcactccttggagaac
tctttaatggatatgataaggactgatcatgagcctctgaaaggtaaacactaccctccc
agtggcccaccaatgagtttcgctgatataatgtggaggaatcattttgcaggacgcatg
ggaataaattttcatcatccaggaacagataatattatggcacttaacaccaggagctat
gggcggagacgaggtcggtcttctctgtttccctttgaagatgccttcctggatgacagt
catggtgatcagtccttgtcatctggcttaagttctcccactcgctgtcaaaatggggaa
cgagtagaacgctactctagaaaggtgtttgttggaggccttcctcctgatatcgatgaa
gatgagatcacagccagcttccgcaggtttggacctctagtcgtagactggcctcacaaa
gctgaaagcaagtcatattttcctcctaaaggctatgcctttctgctgttccaggaggag
agctcagtacaagctttgatagatgcctgcctagaagaagatgggaaactatacctgtgc
gtgtcaagccccaccatcaaggataaaccggtgcaaattcgaccatggaacctaagtgac
agtgactttgtaatggatggttctcagcctttggaccccagaaaaactatctttgttggg
ggagttccacgaccccttcgagctgttgaactggcaatgatcatggaccgtttgtatggt
ggtgtctgctatgctggcattgatacggacccagagctgaagtaccccaaaggtgctggc
cgtgtggcattctccaatcagcagagttatattgcagccatcagtgctcgctttgtgcag
ctccaacacaatgacattgacaaacgggtggaagtgaagccatatgtgctggatgatcag
atgtgtgatgagtgccagggcacacgctgtggtgggaagttcgccccgttcttctgtgcc
aacgtcacctgtctgcagtattactgcgaatactgctgggcgagcatacattcccgtgcc
gggcgggagttccacaaaccgctggtgaaggagggaggcgaccgtcctcgtcatgtccca
ttccgctggagctga

DBGET integrated database retrieval system