KEGG   Rousettus aegyptiacus (Egyptian rousette): 107505355
Entry
107505355         CDS       T06036                                 

Gene name
CACNA1B
Definition
(RefSeq) LOW QUALITY PROTEIN: voltage-dependent N-type calcium channel subunit alpha-1B
  KO
K04849  voltage-dependent calcium channel N type alpha-1B
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04010  MAPK signaling pathway
ray04020  Calcium signaling pathway
ray04721  Synaptic vesicle cycle
ray04723  Retrograde endocannabinoid signaling
ray04725  Cholinergic synapse
ray04726  Serotonergic synapse
ray04727  GABAergic synapse
ray04728  Dopaminergic synapse
ray04930  Type II diabetes mellitus
ray05016  Huntington disease
ray05020  Prion disease
ray05022  Pathways of neurodegeneration - multiple diseases
ray05032  Morphine addiction
ray05033  Nicotine addiction
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107505355 (CACNA1B)
   04020 Calcium signaling pathway
    107505355 (CACNA1B)
 09150 Organismal Systems
  09156 Nervous system
   04727 GABAergic synapse
    107505355 (CACNA1B)
   04725 Cholinergic synapse
    107505355 (CACNA1B)
   04728 Dopaminergic synapse
    107505355 (CACNA1B)
   04726 Serotonergic synapse
    107505355 (CACNA1B)
   04723 Retrograde endocannabinoid signaling
    107505355 (CACNA1B)
   04721 Synaptic vesicle cycle
    107505355 (CACNA1B)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05016 Huntington disease
    107505355 (CACNA1B)
   05020 Prion disease
    107505355 (CACNA1B)
   05022 Pathways of neurodegeneration - multiple diseases
    107505355 (CACNA1B)
  09165 Substance dependence
   05032 Morphine addiction
    107505355 (CACNA1B)
   05033 Nicotine addiction
    107505355 (CACNA1B)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    107505355 (CACNA1B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:ray04040]
    107505355 (CACNA1B)
Ion channels [BR:ray04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   107505355 (CACNA1B)
SSDB
Motif
Pfam: Ion_trans Ca_chan_IQ GPHH PKD_channel
Other DBs
NCBI-GeneID: 107505355
NCBI-ProteinID: XP_015990941
LinkDB
Position
Unknown
AA seq 2325 aa
MVRFGDELGGRYGAPXGGERARGGGAGGAGGPGPGGXQPGQRVLYKQSIAQRARTMALYN
PIPVKQNCFTVNRSLFVFSEDNVVRKYAKRITEWPPFEYMILATIIANCIVLALEQHLPD
GDKTPMSERLDDTEPYFIGVFCFEAGIKIVALGFALHKGSYLRNGWNVMDFVVVLTGILA
TAGTDFDLRTLRAVRVLRPLKLVSGIPSLQVVLKSIMKAMVPLLQIGLLLFFAILMFAII
GLEFYMGKFHKACFPNSTDADPTGDFPCGPEPPARVCEGDTECREYWPGPNFGITNFDNI
LFSVLTVFQCITMEGWTDILYNTNDAAGNTWNWLYFIPLIIIGSFFMLNLVLGVLSGEFA
KERERVENRRAFLKLRRQQQIERELNGYLEWIFKAEEVMLAEEDRNAEEKSPLDVLKRAA
TKKSRNDLIHAEEGEDRFADLCAGGSPFARAGLKSGKTESSSYFRRKEKMLRFLVRRVVK
AQSFYWAVLCVVALNTLCVAMVHHNQPQRLTTALYFAEFVFLGLFLTEMSLKMYGLGPRS
YFRSSFNCFDFGVIVGSIFEVVWAAIKPGTSFGISVLRALRLLRIFKVTKYWNSLRNLVV
SLLNSMKSIISLLFLLFLFIVVFALLGMQLFGGQFNFKDETPTTNFDTFPAAILTVFQIL
TGEDWNAVMYHGIESQGGVSKGMFSSCYFIVLTLFGNYTLLNVFLAIAVDNLANAQELTK
DEEEMEEAANQKLALQKAKEVAEVSPVSAANVSVAARQQSSAKARSVWEQRASQLRLQNL
RASCEALYSELDPEERLRYATTRHLRPDMKTHLDRPLVVEPSRNGPRGPAAGKAQPEGAE
ATEGTDPPRRHHRHRDKDKAPAPAAGEPERADAPKAEGGEPVAREERVRGRTAAATAFRG
PGPEGGATTRHGSPEEVAEREPRRHRTHRHAPDQGKEGSAPGAKGERRARHRGGTRAGAR
EPESMEEPARRHRARHRAPPTHEDAEKEAEEKEXARPKDRDRDKEVRNHQPKEPRGDLGD
GGVTAVGPVHTLPSTCLQKVEEQPEDADNQRNVTRMGSQPADPGAPVHIPAAPTGPPAEG
TVVPSGSGDLESQADGRKAAEAEDVTRSGPRPIVPYSSMFCLSPTALLRRCCHYIVTMRY
FEMVILVVIALSSIALAAEDPVRTDSPRNNALKYLDYIFTGVFTFEMVIKMIDLGLLLHP
GAYFRDLWNILDFIVVSGALVAFAFSGSKGKDINTIKSLRVLRVLRPLKTIKRLPKLKAV
FDCVVNSLRNVLNILVVYVLFMFIFAVIAVQLFKGKFFYCTDESKERERDCRGQYLDYEK
EEVEAQPRQWKKYDFHYDNVLWALLTLFTVSTGEGWPMVLKHSVDATYEEQGPSPGYRME
LSIFYVVYFVVFPFFFVNIFVALIIITFQEQGDKVMSECSLEKNERACIDFAISARPLTR
YMPRDKQSLQYKTWTFVVSPPFEYFIMAMIALNTLVLMMKFYGAPYEYELLLKGLNVAFT
SVFSMECLLKIVAFGVLNYFRDAWNVFDFVTVLGSITDILVTEIAETNNFINLSFLRLFR
AARLIKLLRQGYTIRILLWTFVQSFKALPYVCLLIAMLFFIYAIIGMQVFGNIALDDDSS
INRHNNFRTFLQALMLLFRSATGEAWHEIMLSCLSDRACDEHASASACGSDFAYFYFVSF
IFLCSFLMLNLFVAVIMDNFEYLTRDSSILGPHHLDEFIRVWAEYDPAACGRISYSDMFE
MLKHMSPPLGLGKKCPARVAYKRLVRMNMPISSEDMTVHFTSTLMALIRTALEIKLAPAG
TTQHQCDAELRKEISSVWANLPQKTLDLLVPPHKPDEVTVGKVYAALMIFDFYKQSKSSR
DQTHQAPGGLTQMGPVSLFHPLKATLEQTQPAVLRGARVFLQQKSSTSLSNGGAVQTQES
GIKESVSWGTQRTQDMLCESRRPLERGHSTEIPVVHPGKPAADVQTQSMALRGPDGEPQP
GLESQGRAASMPRLAAETQPAPGASPMKRSVSTLAPQRPRAAPLCNAAPDRAPAGPAAAH
HHHRCHRRRDRKQKSLEKGPSLSADTDGAPHSAGPGPPPAEGPAGGRRERRQERGRSQER
RQPSSSSSEKQRFYSCDRFGGREPPHPRPSLSSHPTSPTAGQEPGPLRQGGGSANGSPLL
SASGASTPGRGGRRQLPQTPLTPRPSVTYKTAHSSPVHFAGAQTSLPAFSPGRLSRGLSE
HNALLQRDPLSQPLAPSSRTGSDPYLGQRLDGETTARTQPEDALTFEEAVATNSGRSSRT
SYVSSLTSQPHPPRRVPNGYHCTLGPGPGSRARLSAHHPDRDHWC
NT seq 6978 nt   +upstreamnt  +downstreamnt
atggtccgcttcggagacgagctgggcggccgctatggggcgccgngcggcggggagcgg
gcccggggcggcggggctggcggggccggcggcccgggcccggggggcntgcagccgggc
cagcgggtcctctacaagcagtcgatcgcgcagcgcgcgcgcaccatggcgctgtacaac
cccatcccggtcaagcagaactgcttcaccgtcaaccgctcgcttttcgtcttcagcgag
gacaacgtcgtccgcaaatacgccaagcgcatcacggagtggcctccgtttgagtacatg
atcctggccaccatcatcgccaactgtatcgtgctggcactggagcagcacctccctgac
ggcgacaagacgcccatgtccgagcggctggacgacacggagccctacttcatcggcgtc
ttctgcttcgaggcgggcatcaagatcgtcgccctgggcttcgcgctgcacaagggctcc
tacctacgcaatggctggaacgtcatggacttcgtggtggtcctcacggggatcctggcc
acagctggcactgacttcgacctgcgaacgctacgtgctgtgcgcgtgctgaggcccctg
aagctggtgtccgggatccccagtttgcaggtggtgctcaagtccatcatgaaggccatg
gtcccactcctgcagattgggctgctcctcttctttgccatcctcatgttcgccatcatt
ggcctggagttctacatgggcaaattccacaaggcctgtttccccaacagcacagatgca
gatcccactggtgacttcccctgtggcccagagccccctgcccgggtgtgtgagggcgac
accgagtgccgggagtactggccagggcccaacttcgggatcaccaacttcgacaacatc
ctgttctccgtcctgacggtgttccagtgcatcaccatggagggctggactgacatcctc
tacaatacaaacgacgcggccggcaacacgtggaactggctctacttcatccctctcatc
atcatcggctccttcttcatgcttaacctggtgctgggcgtgctctctggcgagtttgcc
aaggagcgcgagcgggtggagaaccggcgggccttcctgaagctgcgccggcagcagcag
atcgagcgggagctcaacggatacctggagtggatcttcaaggccgaggaagtcatgctg
gctgaggaggacaggaatgcagaggagaagtcccctctggatgtgctgaagagagcagcc
accaagaagagccggaacgacctgatccacgcagaggagggcgaggaccgcttcgcagac
ctctgtgccggggggtcccccttcgcccgcgccggcctcaagagtgggaagacggagagc
tcgtcgtacttccgccggaaggagaagatgctgcggttcctggtgcggcgagtggtgaag
gcgcagagcttctactgggcagtgctgtgcgtggtggcgctgaacacgctgtgcgtggcc
atggtgcaccacaaccagccccagcggctcaccacggcgctgtactttgcagagtttgtt
ttcctgggtctcttcctcacagagatgtccctgaagatgtatggcctggggccccggagc
tacttccggtcctccttcaattgcttcgacttcggggtcatcgtggggagcatcttcgaa
gtggtgtgggctgccatcaagccaggaacctcctttgggatcagtgttctgcgggcactc
cggttgctgaggatcttcaaagtcacaaagtactggaactccctgcggaacctggtggtg
tccctgctcaactccatgaagtccatcatcagcctgctcttcttgctcttcctcttcatc
gtggtcttcgccctgctgggcatgcagctgttcgggggacagttcaactttaaagatgag
acgccaaccaccaactttgacaccttccctgccgccatcctcactgtgttccagatcctg
accggggaggactggaatgctgtgatgtaccacgggatcgagtcgcagggtggagtcagc
aaaggcatgttctcgtcctgctatttcatcgtcctgacgctgttcgggaactacaccttg
ctgaatgtcttcctggccatcgccgtggacaacctcgccaacgcccaggagctgaccaag
gatgaagaggagatggaggaggcggccaaccagaagctcgccctgcagaaggccaaggag
gtggctgaagtcagccctgtgtcggccgccaacgtctccgtcgctgccaggcagcagagc
tcggccaaggcgcgctcggtgtgggagcagcgggccagccagctgcggctgcagaacctg
cgggccagctgcgaggcgctgtacagcgagctggaccccgaggagcggctgcgctacgcc
accacgcgccacctgcggcccgacatgaagacgcacctggaccggccgctggtggtggag
cccagcaggaatggcccgcgggggccggccgcaggcaaggcccagcccgagggcgcggag
gccaccgagggcacggacccgccacgcaggcaccaccggcaccgcgacaaggacaaggcc
ccggccccggctgccggggagcccgagcgggcggacgccccaaaggcggagggcggggag
ccggtggcccgggaagagcgagtgcgcggccgcaccgcagccgcaacggcattccgcggc
ccggggcctgagggcggcgccaccacccggcacgggtccccggaggaggtggccgaacgg
gagccccggcgccaccgcacccaccggcacgcgcccgaccagggcaaagagggcagcgca
cctggggccaagggcgagcggcgggcacggcaccgcggcggcacccgggccggtgcccgg
gagcccgagagcatggaggagccggcacggcggcaccgggcacggcacagggcgccaccc
acacacgaggacgcggagaaggaggcagaggagaaggagnnggcgagacccaaggacagg
gacagggacaaggaagtccggaaccaccagcccaaggagccacgtggggacctgggggac
ggcggggtgacggctgtgggccctgtgcacacgctgcccagcacctgtctacagaaggtg
gaggagcagccggaggacgcggataaccagcggaacgtcactcggatgggcagccagccc
gcagaccccggtgcccctgtgcacatcccggcggcgccgaccgggccccccgccgagggc
accgttgtccccagtggcagcggggacctggaaagccaagcagatgggaggaaggcggcg
gaggccgaggacgtgacgaggagcggcccccggcccatcgtcccctacagctccatgttc
tgcctgagccccactgccctgctccgccgttgctgccactacatcgtgaccatgaggtac
ttcgagatggtcatccttgtggtcatcgccctgagcagcatcgctctggccgcagaggac
cccgtgcggacagactcgcccaggaacaacgccctgaaatacttggactacatcttcacg
ggcgtcttcacctttgagatggtgatcaagatgattgatctggggctgctgctgcatccc
ggggcctacttccgggacctgtggaatattctggacttcattgtggtcagtggggccctg
gtggcgtttgccttctcgggctccaaagggaaagacatcaacaccatcaagtccctgagg
gtcctgcgtgtcctgcggccgctcaagaccatcaagcggctgcccaagctcaaggccgtg
ttcgactgcgtggtgaactccctgcgcaacgtgctcaacatcctggtcgtctacgtgctc
ttcatgttcatcttcgccgtcatcgccgtgcagctgttcaagggcaagttcttctactgc
acggacgagtccaaggagcgggagcgggactgccggggccagtatctggactacgagaag
gaggaagtggaggcccagcctcggcagtggaagaagtacgacttccactacgacaacgtg
ctctgggcactgctgacgctcttcaccgtgtccactggcgaagggtggcccatggtgctg
aaacactccgtggatgccacctacgaggagcagggcccaagccctgggtaccgcatggag
ctgtccatcttctacgtggtctacttcgtggtctttcccttcttctttgtcaacatcttc
gtggccttgatcatcatcaccttccaggagcagggggacaaggtgatgtcagaatgtagc
ctggagaaaaacgagagggcttgcatcgacttcgccatcagcgccagacccctgacgcgg
tacatgccacgggacaagcagtcgctgcagtacaagacgtggacgttcgtggtgtctcca
cccttcgagtacttcatcatggccatgatagccctcaacacgctggtgctgatgatgaag
ttctacggcgcgccctatgagtacgagctgctgctgaagggcctgaacgtggccttcacc
tccgtgttctccatggagtgcctgctgaagatcgtcgcgttcggggtgctgaactacttc
agagatgcttggaatgtgtttgactttgtcactgtgctgggaagtattactgatatttta
gtgacagaaattgcggaaacgaacaacttcatcaacctgagcttcctgcgcctgttccgc
gcggcgcggctcatcaagctgctgcgccagggctacaccatccgcatcctgctgtggacc
ttcgtgcagtccttcaaggccctgccctacgtgtgcctgctcatcgccatgctcttcttc
atctacgccatcatcggcatgcaggtgttcgggaacatcgccctggacgatgactccagc
atcaacagacacaacaacttccggacgtttctacaggccttgatgctgctgttcaggagc
gccacaggggaggcctggcacgagatcatgctgtcctgcctcagcgaccgggcctgcgac
gagcatgccagcgccagcgcctgcggcagcgacttcgcctacttctacttcgtgtccttc
atcttcctgtgctccttcctgatgctgaacctcttcgtggctgtgatcatggacaacttc
gagtacctcacacgggactcgtccatcctggggccgcaccacctggacgagttcatccga
gtgtgggccgagtacgacccggccgcgtgcgggcgcatcagttacagtgacatgtttgag
atgctgaagcacatgtccccgcccctggggctggggaagaagtgcccggcccgagttgcc
tacaagcgcctggtccgcatgaacatgcccatctccagtgaggacatgaccgtccacttc
acgtccacactgatggccctcatccggaccgcgctagagatcaagctggctccagccggc
accacgcagcaccagtgcgacgcagagctgaggaaggagatctcctccgtgtgggccaac
cttccccagaagactctggatttgctggtgccaccccataaacccgacgaggtgacggtg
gggaaagtctacgccgccctgatgatcttcgacttctacaaacagagcaaaagcagcagg
gaccagactcaccaagccccgggaggcctgacccagatgggtcccgtgtccctgtttcac
cctctgaaggccacgctggagcagacacagccggctgtgctccgaggggcccgggttttc
cttcagcagaagagctcgacctctctcagcaatggcggggcggtacaaacccaagagagt
ggcatcaaggagtctgtttcctggggcacccaaaggacccaggacatgctctgtgagtca
aggaggcccctagagcgtggccactcgacagagatcccagtggtgcatcccggaaaacca
gctgcggatgtccagacgcagagcatggccctgaggggccctgacggggagccccagcct
gggctggagagccagggccgtgcggcctccatgccccgcctggcagcagagacacagccg
gcccccggcgccagccccatgaagcgctcggtgtccacgctggcgccgcagcgcccccgc
gcggccccgctgtgcaacgccgccccggaccgcgcccccgccggcccggccgccgcgcac
caccaccaccgctgccaccgccgcagggacaggaagcagaagtccctggagaaggggccc
agcctgtccgcggacacggatggcgccccccacagcgcggggccggggccgcccccggcg
gaggggcccgcaggcggccggcgggagcgcaggcaggagcgcggccggtcccaggagcgc
aggcagccgtcgtcgtcgtcctccgagaagcagcgcttctactcgtgcgaccgcttcggg
ggccgcgagcccccgcacccccggccctccctcagcagccaccccacctcgcccacggcc
gggcaggagccaggacccctgaggcagggtggcggctcggcaaacgggagccccttgctg
tcagcatccggtgctagcacccctggccgtggcgggcggaggcagctcccccagacccca
ttgacgccccggcccagcgtcacctacaagacagcgcactcctcgcctgtgcacttcgcg
ggggctcagaccagcctcccggccttctcccccggccggctgagccgaggcctttccgaa
cacaacgccttgctccagagagaccccctcagccagcccctggcccccagctctcggact
ggctctgacccttacctggggcagcgtcttgacggtgagaccacggcccgcacccagccc
gaggacgcactcaccttcgaggaggccgtggccaccaactccggccgctcctcccggact
tcctacgtgtcctccctgacttcgcagccccatcccccccgccgcgtgcccaacgggtac
cactgcaccctgggcccgggccccggcagccgagcacgtctcagtgcccaccaccccgac
cgggaccactggtgctag

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107519399
Entry
107519399         CDS       T06036                                 

Gene name
CACNA1A
Definition
(RefSeq) voltage-dependent P/Q-type calcium channel subunit alpha-1A isoform X1
  KO
K04344  voltage-dependent calcium channel P/Q type alpha-1A
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04010  MAPK signaling pathway
ray04020  Calcium signaling pathway
ray04721  Synaptic vesicle cycle
ray04723  Retrograde endocannabinoid signaling
ray04724  Glutamatergic synapse
ray04725  Cholinergic synapse
ray04726  Serotonergic synapse
ray04727  GABAergic synapse
ray04728  Dopaminergic synapse
ray04730  Long-term depression
ray04742  Taste transduction
ray04930  Type II diabetes mellitus
ray05017  Spinocerebellar ataxia
ray05032  Morphine addiction
ray05033  Nicotine addiction
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107519399 (CACNA1A)
   04020 Calcium signaling pathway
    107519399 (CACNA1A)
 09150 Organismal Systems
  09156 Nervous system
   04724 Glutamatergic synapse
    107519399 (CACNA1A)
   04727 GABAergic synapse
    107519399 (CACNA1A)
   04725 Cholinergic synapse
    107519399 (CACNA1A)
   04728 Dopaminergic synapse
    107519399 (CACNA1A)
   04726 Serotonergic synapse
    107519399 (CACNA1A)
   04730 Long-term depression
    107519399 (CACNA1A)
   04723 Retrograde endocannabinoid signaling
    107519399 (CACNA1A)
   04721 Synaptic vesicle cycle
    107519399 (CACNA1A)
  09157 Sensory system
   04742 Taste transduction
    107519399 (CACNA1A)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05017 Spinocerebellar ataxia
    107519399 (CACNA1A)
  09165 Substance dependence
   05032 Morphine addiction
    107519399 (CACNA1A)
   05033 Nicotine addiction
    107519399 (CACNA1A)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    107519399 (CACNA1A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:ray04040]
    107519399 (CACNA1A)
Ion channels [BR:ray04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   107519399 (CACNA1A)
SSDB
Motif
Pfam: Ion_trans Ca_chan_IQ GPHH PKD_channel DUF2207
Other DBs
NCBI-GeneID: 107519399
NCBI-ProteinID: XP_016017538
LinkDB
Position
Unknown
AA seq 2580 aa
MWKSSWVLDPMFSPYSYYDALHNGGLGAPGPAPLGPPSVPQVPQSHRMSSICEGPPLKRR
GGLVDHRDVILAHQAHKIHSTPQARRKEWEMARFGDEMPARYGGGGSGAAAGVVVGAGGG
RGAGGSRQGGQPGAQRMYKQSMAQRARTMALYNPIPVRQNCLTVNRSLFLFSEDNVVRKY
AKKITEWPPFEYMILATIIANCIVLALEQHLPDDDKTPMSERLDDTEPYFIGIFCFEAGI
KIIALGFAFHKGSYLRNGWNVMDFVVVLTGILATVGTEFDLRTLRAVRVLRPLKLVSGIP
SLQVVLKSIMKAMIPLLQIGLLLFFAILIFAIIGLEFYMGKFHTTCFEEGTDDIQGESPA
PCGTEEPARTCPNGTKCQPYWEGPNNGITQFDNILFAVLTVFQCITMEGWTDLLYNSNDA
SGNTWNWLYFIPLIIIGSFFMLNLVLGVLSGEFAKERERVENRRAFLKLRRQQQIERELN
GYMEWISKAEEVILAEDETDGEQRHPFDVGALRRATIKKSKTDLLNPEEAEGQLADIASV
GSPFARASIKSAKLENSTFFHKKERRVRFYIRRMVKTQAFYWTVLSLVALNTLCVAIVHY
NQPEWLSDFLYYAEFIFLGLFMSEMFIKMYGLGTRPYFHSSFNCFDCGVIIGSIFEVIWA
VIKPGTSFGISVLRALRLLRIFKVTKYWASLRNLVVSLLNSMKSIISLLFLLFLFIVVFA
LLGMQLFGGQFNFDEGTPPTNFDTFPAAIMTVFQILTGEDWNEVMYDGIKSQGGVQGGMV
FSIYFIVLTLFGNYTLLNVFLAIAVDNLANAQELTKDEQEEEEAANQKLALQKAKEVAEV
SPLSAASMSIAVKEQQKNQKPAKSVWEQRTSEMRKQNLLASREALYNEMDPDERWKATYA
RHLRPDMKTHLDRPLVVDPQENRNNNTNKSRAAEPTVDQRLGQQRAEDFLRKQARYHDRA
RDPSGSVGLDARRPWAGSQEAELSREGPYGRESDHHAREGGLEPPGFWEGEAERPKAGDP
HRRHAHRPGGSRESRSGSPRTGADGEPRRHRAHRRPGEEALEDKAERRSRHREGCRPARG
GEGEGPDGGERRRRHRHGPPATYDMETRREDRERRHRRRKDNQGSGVPVSGPNLSTTRPI
QQDLGRQDPPLAEDIDNMKNNKLATAESASPHDSLGHSGLPQSPAKMGNSTHPGSTPAPP
ATATNPQNTASRRVPNNPGNPSNPGPPKTPENSLIVTNPSSTQTNSAKTARKPDHTTVDI
PPACPAPLNHTVVQVNKNANPDPLPKKEEKKKEEEEDDPGEDGPKPMPPYSSMFILSTTN
PLRRLCHYILNLRYFEMCILMVIAMSSIALAAEDPVQPNAPRNNVLRYFDYVFTGVFTFE
MVIKMIDLGLVLHQGAYFRDLWNILDFIVVSGALVAFAFTSSTRGNSKGKDINTIKSLRV
LRVLRPLKTIKRLPKLKAVFDCVVNSLKNVFNILIVYMLFMFIFAVVAVQLFKGKFFHCT
DESKEFEKDCRGKYLLYEKNEVKARDREWRKYEFHYDNVLWALLTLFTVSTGEGWPQVLK
HSVDATFENQGPSPGYRMEMSIFYVVYFVVFPFFFVNIFVALIIITFQEQGDKMMEEYSL
EKNERACIDFAISAKPLTRHMPQNKQSFQYRMWQFVVSPPFEYTIMAMIALNTIVLMMKF
YGASLAYENALRVFNIVFTSLFSLECLLKVMAFGILNYFRDAWNIFDFVTVLGSITDILV
TEFGNPNNFINLSFLRLFRAARLIKLLRQGYTIRILLWTFVQSFKALPYVCLLIAMLFFI
YAIIGMQVFGNIGIDVEDEDSDEDEFQITEHNNFRTFFQALMLLFRSATGEAWHNIMLSC
LSGKPCDKNSGILTPECGNEFAYFYFVSFIFLCSFLMLNLFVAVIMDNFEYLTRDSSILG
PHHLDEYVRVWAEYDPAAWGRMPYPDMYQMLRHMSPPLGLGKKCPARVAYKRLLRMDLPV
ADDNTVHFNSTLMALIRTALDIKIAKGGADKQQMDAELRKEMMAIWPNLSQKTLDLLVTP
HKSTDLTVGKIYAAMMIMEYYRQSKAKKLQAMREEQNRTPLMFQRMEPPSPTQEGVPGQN
ALPSTQLDPGGGLMAHEGGIKESPSWVTQRAQEMFQKTGTWSPERGPPTDMPNSQPNSQS
VEMREMGRDGYSDSERYLPMEGQARATSMPRLPAENQRRRGRPRGNNLSTISDTSPMKRS
ASVLGPKARRLDDYSLERVPPEENQRHHQRRRDRSHRASERSLGRYTDVDTGLGTDLSMT
TQSGDLPSKERDQERGRPKDRKHRQHHHHHHHHHPPPPDKERYAQERQDHRARTRDQRWS
RSPSEGREHMAHRQGSSSVSGSPAPSTSGTSTPRRGRRQLPQTPSTPRPHVSYSPVIRKA
GGMGPPQQQQQPVARPGRAAPSGPRRYPGPAAEPLAGERPPGGHGSSRSPAMERRGPARS
ESPRACRHSGARWPASVAHASEGPLGSRHHGYYRGSDYDEANGPGVSGDDGPYDVLPPAR
HACSPRTPRATGPACASPSRHGRRLPNGYYPAHGLARPRGPGSRKGLHEAYSETDDDDWC
NT seq 7743 nt   +upstreamnt  +downstreamnt
atgtggaagtcctcctgggtcctggaccccatgttctccccctacagctattatgatgcc
ctgcacaacggtggcttgggggcaccaggtccggcccccttgggcccgcccagcgtcccg
caggtcccacagtcccaccggatgagcagcatctgcgaagggccccctctgaagcggcgg
ggcggcctggtggaccaccgggatgtcatcttggcccaccaggcgcacaaaatccacagc
accccccaggccaggaggaaggaatgggaaatggcccgcttcggagacgagatgccggcc
cgctacgggggaggaggctccggggcagccgccggggtggtcgtgggcgccggaggcggg
cgaggagccgggggcagccggcagggcgggcagcccggggcgcaaaggatgtacaagcag
tcaatggcgcagagagcgcggaccatggccctctacaaccccatccccgtccgacagaac
tgcctcacggtcaaccggtctctgttcctcttcagcgaggacaacgtggtgagaaaatac
gccaaaaagatcaccgaatggcctccctttgaatatatgattttagccaccatcatagca
aactgcatcgtccttgccctggagcagcacctgcctgatgatgacaagacccccatgtct
gaacgattggatgacacagaaccgtacttcattggaattttttgtttcgaggctggcatt
aaaatcatcgcccttgggtttgccttccacaaaggctcttacttgaggaatggttggaat
gtgatggacttcgtcgtggtgctaacaggcatcttggcaacagtcgggacggagtttgac
ctgcggacactaagggcggttcgagtgctgcggcctctcaagctggtgtctgggatccca
agtttacaagtcgtcctgaagtcgatcatgaaggcgatgatccccttgctgcagatcggc
cttctcctattttttgcaatccttatttttgcaatcatagggttagaattttatatgggg
aaatttcataccacctgctttgaagaggggacagatgacattcagggtgagtctccagct
ccatgtgggacagaggaacccgcccgcacctgccccaatgggaccaaatgtcagccctac
tgggaagggcccaacaatgggatcactcagtttgacaacatcctgtttgcagtactgact
gttttccagtgcatcaccatggaagggtggactgacctcctctacaatagcaacgatgcc
tcagggaacacttggaactggttgtacttcatccctctcatcatcattggctcctttttt
atgctgaacctcgtgctgggtgtgctgtcaggagagtttgccaaagaaagggagcgggtg
gaaaaccggcgggcttttctaaagctgaggcggcagcaacagatcgaacgagagctcaat
gggtacatggagtggatctcaaaagcagaagaggtgatcctcgccgaggatgaaaccgac
ggggagcagaggcacccctttgatgttggagctctgcggagagccaccataaagaagagc
aagacagacctgctcaaccccgaggaggccgagggtcagcttgccgatatcgcctctgtg
ggctctccctttgcccgagccagcattaaaagtgccaagctggagaactcgacttttttt
cacaaaaaggagaggagggtgcgtttctacatccgccgcatggtcaaaactcaggccttc
tactggactgtgctcagtctggtagccctcaacacgctgtgtgttgctatcgttcactac
aaccagcccgagtggctctccgacttcctctactatgcagaattcattttcttaggactc
tttatgtccgaaatgtttataaaaatgtacgggcttgggacacggccttacttccactct
tccttcaactgctttgactgtggggtcatcatcggaagcatctttgaggtcatctgggcc
gtcataaaacctggcacatcctttggaatcagcgtgttacgagctctcaggttattgcgt
attttcaaagtcacaaagtactgggcatctctcaggaacctggtggtctctcttctcaac
tccatgaaatccatcatcagcctgctgttcctccttttcctgttcatcgtcgtctttgca
cttttgggaatgcagcttttcggtggccagtttaatttcgacgaagggactcctcctacc
aacttcgacacttttccagcagcaataatgacagtgtttcagattctgactggtgaggac
tggaacgaggtcatgtacgacggcatcaaatctcagggcggcgtgcagggtggcatggtg
ttctccatctacttcatcgtgctgacgctctttgggaactacaccctcctgaatgtgttc
ctggccattgcggtggataatttggccaatgctcaggagctcaccaaggacgaacaagaa
gaagaagaggcagccaaccagaaacttgccctccagaaagccaaggaggtggcagaagtg
agtcctctgtccgcggccagcatgtccatagctgtgaaggagcaacagaagaaccagaag
ccagccaagtccgtgtgggagcagcggacaagcgagatgcgcaagcagaacctgctggcc
agccgggaggccctctacaatgagatggacccggatgagcgctggaaggccacctacgcc
cggcacctgcggcccgacatgaagacccacctggaccggccgctggtggttgatccccag
gagaaccgcaacaacaacaccaacaagagccgggcggccgagcccacggtggaccagcgc
ctgggccagcagcgcgccgaggacttcctccggaaacaggcgcgctaccacgaccgggcc
cgggaccccagcggctccgtgggcttggacgcgcggcggccctgggccggcagccaggag
gccgagctgagccgggaggggccttatggccgtgagtcggaccaccacgcccgtgagggc
ggcctggagccgccgggcttctgggagggagaggccgagcgccccaaggccggcgacccc
caccggaggcacgcgcatcggccggggggcagccgggagagccgcagcgggtccccgcgc
accggagctgatggcgagccccgccggcaccgggcccatcgcaggccaggcgaggaggcc
ctggaggacaaggccgagcgcagatcccggcaccgcgagggctgccggccggcccgggga
ggcgagggcgagggccctgatggcggcgagcggaggcggcggcaccggcacggccccccg
gccacgtatgacatggagacacggagggaggacagggagcgcaggcaccggaggaggaaa
gacaaccagggctctggggtccctgtgtcgggccccaacctgtcgaccacccggccgatc
cagcaagatctgggccgccaagacccaccgctggctgaggacatcgacaacatgaagaac
aacaagctggccactgcggagtcggccagtcctcacgacagcctcggccactccggcctg
ccccagagcccagccaagatggggaacagcacccaccccggctccacgccggccccacct
gccacggccaccaatccccagaacaccgccagccgccgcgtgcccaacaacccggggaac
ccgtccaaccccggccccccgaagacccccgagaacagccttatcgtcaccaaccccagc
agtacccagaccaactcagctaagactgccaggaaacccgaccacaccacggtggacatc
cccccagcctgcccagcccccctcaaccacaccgttgtccaagtgaacaaaaacgccaac
ccagacccactgccaaaaaaggaggaaaagaagaaggaggaggaggaagacgaccccggg
gaagacggccccaagcccatgcccccctacagttccatgtttatcctctccacgaccaac
ccccttcgccgcctgtgccattacatcctgaacctgcgctactttgagatgtgcatcctc
atggtcatcgccatgagcagcatcgccctggcagccgaggaccccgtgcagcccaatgca
ccccggaacaacgtcctacgatattttgactacgttttcacaggtgtttttacctttgag
atggtaatcaagatgattgacctggggctcgtcctacaccagggtgcctacttccgtgat
ctctggaacattctcgacttcatagtggtcagtggggccttggtagcctttgccttcacg
agcagtacacgtggcaacagcaaaggaaaggacatcaacacgattaaatccctccgagtc
ctccgggtgctacgacctcttaaaaccatcaagcggttgccaaagctcaaggcggtgttt
gattgtgtggtgaattctctcaagaacgtcttcaacatcctcattgtctacatgctgttc
atgttcatctttgctgtggtggccgtgcagctcttcaaggggaagttcttccactgcact
gatgaatctaaggagtttgagaaggactgtcgtggcaagtacctcctctatgaaaagaac
gaggtgaaggcacgggaccgagagtggaggaagtatgagttccattatgacaacgtactg
tgggctctgctgaccctcttcactgtgtccacgggagaaggctggccgcaggtcctcaag
cactccgtagatgccaccttcgagaatcagggtcccagccccgggtaccgcatggagatg
tccatcttctacgtcgtctactttgtcgtgttccccttcttcttcgtcaatatctttgtg
gccttgatcatcatcaccttccaggagcagggggacaagatgatggaggaatacagcctg
gagaaaaatgagagggcctgcatcgacttcgccatcagcgccaaacctctgacccgacac
atgccccagaacaagcagagcttccagtaccgcatgtggcagtttgtggtgtctccgcct
ttcgagtacaccatcatggccatgatcgccctcaacaccattgtgctcatgatgaagttc
tatggggcctcgcttgcttatgaaaatgctctgagggtattcaacatcgtcttcacctcc
ctcttctctctggaatgtcttctgaaagtcatggcttttgggattctgaattatttccgt
gatgcctggaacatcttcgactttgtgactgttctgggcagcatcaccgacatcctcgtg
actgagtttgggaatccgaataacttcatcaacctgagcttcctccgcctcttccgagct
gctcgcctcatcaaactcctccgtcaaggttacaccatccgaattcttctctggaccttt
gtgcagtcattcaaggctctgccatatgtctgtctgctgattgccatgcttttcttcatc
tacgccatcatcgggatgcaggtgtttggcaacatcggtatcgacgtggaggacgaggac
agtgacgaggatgagttccagatcactgagcacaataacttccggacctttttccaggcc
ctcatgcttctcttccggagtgccaccggggaggcttggcacaacatcatgctttcctgc
ctcagtgggaagccatgtgataagaactctggcatcctgactcccgagtgtggcaatgag
tttgcttatttttacttcgtttccttcatcttcctctgctcgtttttgatgctgaacctc
tttgtcgccgttatcatggacaactttgagtacctcactcgagattcctccatcctgggg
ccccaccacctggatgagtacgtgcgtgtctgggccgagtacgaccccgcagcatggggc
cgcatgccttacccggacatgtatcagatgctgagacacatgtctccgcccctgggtctg
gggaagaagtgtccggccagagtggcttacaagagactactgcggatggatctgcccgtc
gctgatgacaacactgtccacttcaattctaccctcatggctctaatccgcactgccctg
gacatcaagattgccaagggaggggctgacaaacagcagatggacgccgagctacggaaa
gagatgatggccatctggcctaacctgtcccagaagacactggacctgctggtcacccct
cacaagtccacggacctgacagtggggaagatctatgcagccatgatgatcatggagtac
taccggcagagcaaggctaaaaagctacaggccatgcgagaggagcagaaccggacaccc
ctcatgttccagcgcatggagcccccatcaccaacgcaggagggggtgcctggccagaat
gcccttccctccacccagctggacccaggaggaggcctgatggctcacgaaggtggcatc
aaggagagcccttcctgggtgacccagcgagcccaagagatgttccagaagacgggcacg
tggagcccagagcgggggccccctaccgacatgcccaacagccagcccaactctcagtct
gtggagatgcgagagatgggccgggatggctactcagacagtgagcgctacctccccatg
gaaggccaggccagggccacctccatgccgcgcctccccgcggagaaccagaggagaagg
ggccggccacgtgggaataacctcagtaccatctcagataccagccccatgaagcgctca
gcctctgtgctgggccctaaggcccggcggctggatgactactccctagagagggtgccg
cctgaggagaaccagcggcaccaccagcggcgccgtgaccgcagccaccgcgcctccgag
cgctccctgggccgatacacagacgtggacacaggcttggggacagacctaagcatgacc
acccagtccggggacctgccatcgaaggagcgggaccaggagcggggccggcccaaggac
cggaagcaccggcagcaccatcaccaccaccaccaccaccaccccccaccccctgacaag
gagcgctatgcccaagagaggcaggaccaccgagcccggacccgggaccagcggtggtcc
cgctcccctagcgagggccgagagcacatggcacaccggcagggcagtagttccgtaagt
ggaagcccagccccctcaacatctggtaccagcactccgcggcggggccgccgccagctc
ccccagaccccctccactccccggccacatgtgtcctattcccccgtgatccgcaaagcc
ggcggaatggggcccccgcagcaacagcagcagccggtggcgcggcctggccgggcggcc
cccagcggcccgcggaggtacccaggccccgcagccgagcctttggccggggagcggccg
ccagggggacacggcagcagccgctcgcccgcaatggagcggcggggcccggcccggagc
gagtcccccagggcgtgccgccacagtggggcgcggtggccggcgtccgttgcgcacgcg
tccgaggggcccctgggctctcggcaccatggttactaccggggctccgactatgacgag
gccaatggcccgggcgtcagcggggacgacggaccctacgacgtgctgccccccgcgcga
cacgcctgttcgcccaggactccccgggccacgggcccggcctgcgcgtcgccttcccga
cacggccggcgactccccaacggctactaccccgcccacggactggccaggccccgcggg
ccgggctcccggaaaggcctgcacgaagcctacagcgagacggacgacgacgactggtgc
taa

DBGET integrated database retrieval system