KEGG   Rousettus aegyptiacus (Egyptian rousette): 107505383
Entry
107505383         CDS       T06036                                 

Gene name
IL2
Definition
(RefSeq) interleukin-2 isoform X1
  KO
K05429  interleukin 2
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04060  Cytokine-cytokine receptor interaction
ray04061  Viral protein interaction with cytokine and cytokine receptor
ray04151  PI3K-Akt signaling pathway
ray04625  C-type lectin receptor signaling pathway
ray04630  JAK-STAT signaling pathway
ray04658  Th1 and Th2 cell differentiation
ray04659  Th17 cell differentiation
ray04660  T cell receptor signaling pathway
ray04672  Intestinal immune network for IgA production
ray04940  Type I diabetes mellitus
ray05135  Yersinia infection
ray05142  Chagas disease
ray05162  Measles
ray05166  Human T-cell leukemia virus 1 infection
ray05200  Pathways in cancer
ray05320  Autoimmune thyroid disease
ray05321  Inflammatory bowel disease
ray05330  Allograft rejection
ray05332  Graft-versus-host disease
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    107505383 (IL2)
   04151 PI3K-Akt signaling pathway
    107505383 (IL2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    107505383 (IL2)
   04061 Viral protein interaction with cytokine and cytokine receptor
    107505383 (IL2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    107505383 (IL2)
   04660 T cell receptor signaling pathway
    107505383 (IL2)
   04658 Th1 and Th2 cell differentiation
    107505383 (IL2)
   04659 Th17 cell differentiation
    107505383 (IL2)
   04672 Intestinal immune network for IgA production
    107505383 (IL2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107505383 (IL2)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    107505383 (IL2)
   05321 Inflammatory bowel disease
    107505383 (IL2)
   05330 Allograft rejection
    107505383 (IL2)
   05332 Graft-versus-host disease
    107505383 (IL2)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    107505383 (IL2)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    107505383 (IL2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    107505383 (IL2)
   05162 Measles
    107505383 (IL2)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    107505383 (IL2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ray04052]
    107505383 (IL2)
   00536 Glycosaminoglycan binding proteins [BR:ray00536]
    107505383 (IL2)
Cytokines and growth factors [BR:ray04052]
 Cytokines
  Interleukins
   107505383 (IL2)
Glycosaminoglycan binding proteins [BR:ray00536]
 Heparan sulfate / Haparin
  Cytokines
   107505383 (IL2)
SSDB
Motif
Pfam: IL2
Other DBs
NCBI-GeneID: 107505383
NCBI-ProteinID: XP_015990988
LinkDB
Position
Unknown
AA seq 152 aa
MHKMYFLSCIALTLALVADGAPTSSSRKETQQQLEHLLKDLQLLLNTVNNSKKHELSSML
TFKFHMPKATELKHLQCLVDELKPLEEVLTIAQSKNSHSKIKELVSNINVTAQKLKGPET
KSTCDYDDDRVTVREFLNNWITFCQSIFSTLP
NT seq 459 nt   +upstreamnt  +downstreamnt
atgcacaagatgtacttcttgtcttgcatcgcactaactcttgcactggtggcagatggt
gcacctacttcaagctctaggaaggaaacacagcaacagctggagcatttgctgaaggac
ttgcagctgcttttgaacacagttaacaattccaagaaacacgaactctccagtatgctc
acctttaaatttcacatgcccaaggccacagaactgaaacatctgcagtgcctcgtggac
gaactcaaacctttggaggaagtgctaactatagctcaaagcaaaaactctcactcaaag
atcaaggaattagtgagcaatatcaacgtaacagctcagaaactaaagggtcctgaaaca
aaatccacatgtgactatgatgatgacagagtaactgttagagaatttctgaacaattgg
attaccttttgccaaagcatcttctcgacactgccttaa

DBGET integrated database retrieval system