KEGG   Rousettus aegyptiacus (Egyptian rousette): 107505449
Entry
107505449         CDS       T06036                                 

Gene name
CCKAR
Definition
(RefSeq) cholecystokinin receptor type A
  KO
K04194  cholecystokinin A receptor
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04020  Calcium signaling pathway
ray04080  Neuroactive ligand-receptor interaction
ray04911  Insulin secretion
ray04972  Pancreatic secretion
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    107505449 (CCKAR)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    107505449 (CCKAR)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    107505449 (CCKAR)
  09154 Digestive system
   04972 Pancreatic secretion
    107505449 (CCKAR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:ray04030]
    107505449 (CCKAR)
G protein-coupled receptors [BR:ray04030]
 Rhodopsin family
  Peptide
   Cholecystokinin
    107505449 (CCKAR)
SSDB
Motif
Pfam: 7tm_1 CholecysA-Rec_N 7TM_GPCR_Srsx 7tm_4 7TM_GPCR_Srx
Other DBs
NCBI-GeneID: 107505449
NCBI-ProteinID: XP_015991105
LinkDB
Position
Unknown
AA seq 428 aa
MDVVDSLLVNGSNGTPPCELGIKNETLFCLDQPRPSKEWQPAVQILLYSLIFLLSVLGNT
LVITVLIRNKRMRTVTNIFLLSLAISDLMLCLFCMPFNLIPNLLKDFIFGSAVCKTTTYF
MGTSVSVSTFNLVAISLERYGAICKPLQSRVWQTKSHALKVIAATWCLSFTIMTPYPIYS
NLVPFTKNNNQTANMCRFLLPNDVMQQSWHTFLLLILFLIPGIVMMVAYGLISLELYQGI
KFDASQKKSARERKPSAGSSGRYEDSDGCYLQKSKHPRRLELQRLSPGGSGRVNRIRSSS
SAANLMAKKRVIRMLMVIVVLFFLCWMPIFSANAWRAYDTASAERHLSGTPISFILLLSY
TSSCVNPIIYCFMNKRFRLGFMATFPCCPHPGPPGARGEPGEEEEGRTTRASLSRYSYSH
MSASAPPP
NT seq 1287 nt   +upstreamnt  +downstreamnt
atggatgtggtcgacagccttcttgtgaatggaagcaacggcacccctccttgtgaacta
ggcatcaaaaatgagacgcttttctgcttggatcagcctcgcccgtccaaagagtggcag
ccagctgtgcagattctcttgtattccttgatattcctgctcagcgtgctggggaacacg
ctggtcatcacggtgctgatccgaaacaagaggatgagaactgtcaccaacatcttcttg
ctgtccctggccatcagcgacctcatgctctgcctcttctgcatgccgttcaacctcatc
cccaacctgctcaaggatttcatcttcgggagcgccgtttgcaagaccaccacctacttc
atgggcacctctgtgagtgtatccacttttaatctggtcgccatatctctggagcgatac
ggtgcgatttgtaaacccttacagtcccgggtctggcagacgaaatcccatgctttgaag
gtgattgctgctacctggtgcctctcctttaccatcatgactccatacccaatttatagc
aacttggtgccttttaccaaaaataacaaccagaccgcgaatatgtgccgctttctactg
ccaaatgatgttatgcagcagtcctggcacacgttcctgttactcatcctctttcttatt
cctggaatcgtaatgatggtagcgtatggattaatctctttggaactttaccaaggaata
aaatttgatgctagccagaagaagtctgctagagaaaggaaaccgagcgccggcagcagc
ggccgatacgaggacagtgacgggtgttacctgcagaagtccaagcacccacgcaggctg
gagcttcagcgcctgtcgcccggcggcagcggcagggtcaaccgcatcaggagcagcagc
tctgcggccaacctgatggccaagaagcgggtgatccgcatgctcatggtcatcgtggtc
ctcttcttcctgtgctggatgcccatcttcagcgccaacgcctggcgggcctatgacacg
gcctccgccgaacgccacctctcggggacccccatttccttcatcctcctgctctcctac
acctcctcctgcgtcaaccccatcatctactgcttcatgaacaaacggttccgcctcggc
ttcatggccaccttcccctgctgcccccaccctggtccccccggggcgagaggagagccg
ggagaggaggaggaaggcaggaccacgcgggcctcgctgtccaggtactcgtacagccac
atgagcgcctccgccccgcccccgtga

DBGET integrated database retrieval system