KEGG   Rousettus aegyptiacus (Egyptian rousette): 107505522
Entry
107505522         CDS       T06036                                 

Gene name
SMC1B
Definition
(RefSeq) structural maintenance of chromosomes protein 1B isoform X1
  KO
K06636  structural maintenance of chromosome 1
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04110  Cell cycle
ray04114  Oocyte meiosis
Brite
KEGG Orthology (KO) [BR:ray00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    107505522 (SMC1B)
   04114 Oocyte meiosis
    107505522 (SMC1B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ray03036]
    107505522 (SMC1B)
Chromosome and associated proteins [BR:ray03036]
 Eukaryotic type
  Sister chromatid cohesion proteins
   Cohesin complex
    107505522 (SMC1B)
  Meiosis-specific sister chromatid cohesion proteins
    107505522 (SMC1B)
SSDB
Motif
Pfam: SMC_N SMC_hinge AAA_15 AAA_21 AAA_23 AAA_29 ATG16 SbcCD_C
Other DBs
NCBI-GeneID: 107505522
NCBI-ProteinID: XP_015991199
LinkDB
Position
Unknown
AA seq 1235 aa
MGRLELLLVENFKSWRGRQVIGPFRKFTCIIGPNGSGKSNVMDALSFVMGEKTANLRVKN
IQELIHGAHIGKPVSSSASVKIVYVEESGKEKTFARIIRGSCSEFHFDDNPVSRSAYIAE
LEKIGIIVKAQNCLVFQGTVESISMKKPKERTQFFEEISSSGDLIGEYEEKKRKLQKAEE
DAQFNFNKKKNVAAERKHAKLEKEEAERYQSLLEELKINKIELQLFQLYHNEKKIHFLST
ELEHMNRDLRATQESLSHHENIIKANKKEHGMLTRQLQQTEKEIKSLEALLNQKRPQYIK
AKENTSYHLKKLDVAKKSIKDSEKQCAKQEDDIKALETELVDLDGAWKSFEKQIEEEVLR
KVRDIELEASQLDNYKELKEQVRKKVAIMTQQLEKLQWEQKADKERLAFEKRRHAEVKEN
LKQVKEQIEDHKKRIEKLEEYTKTCIDCLKEKKQQEETLVGEIEKTKSRISEINEEMTLI
GSELQNAGIDNHEGKREKKRAEVLEHLKRLYPDSVFGRLLDLCHPIHKKYQLAVTKLFGR
YMIAIVVTSEKVARDCIRFLKEERAEPETFLALDYLDIKPINERLREIKGCKMVIDVIKT
QFPQLKKVIQFVCGNGLVCETVEEARHIAFNGPERRKTVALDGTLFLKSGVISGGSSDLK
YKARCWDEKELKNLRDRRTQLTQELKDLMKMLRKEADLKQIQTLVQGTHTRLKYSQSELE
IIKKKHLAAFYREQSQLQSELLNIESQCTMLSEGIKGRQQRIEEFQEKIDKVEDDIFQHF
CEEIGLENIREFEKRHVKQQQEIDQKRLEFEKQKTLLNIQLEYSRNQLKKKLNKINTLKE
TIQKGREDIDNLKKAEENCLQVVDELMVKWQQLKDMFVAQNSNTEKIQAQIEEERRKFLA
VDREVGKRQKEVIILQSSLEQKRLEKHNLLLDCKVQDIEITLLLGSLDDIIEVELGTEAE
STQATVDIYEKEEAIEIDYSSLREDLKALQSDKEIEAHLRLLLQHVASQEDVLLKTAAPN
LRALENLKTVRDKFQESTDAFEASRKEARICRQEFEQVKKKRYDLFSQCFEHVSVSIDQI
YKKLCRNNSAQAFLSPENPEEPYLEGISYNCVAPGKRFMPMDNLSGGEKCVAALALLFAV
HSFRPAPFFVLDEVDAALDNTNIGKVSSYIKEQTQEQFQMIIISLKEEFYSKADALIGIY
PEQDDCMFSRVLTLDLSQYPDTEGQESSERPRESH
NT seq 3708 nt   +upstreamnt  +downstreamnt
atggggcgcttggagctgctcctcgtcgagaacttcaagtcgtggcgaggccgccaggtc
atcggccccttcaggaaattcacctgcattatcggccccaacggctcgggaaaatctaat
gtaatggacgcgcttagttttgtaatgggagagaaaacagctaatttaagagtgaaaaat
attcaagaactcattcatggagcacatattggaaaacctgtttcttcttctgcaagtgtg
aaaattgtgtatgtggaggaaagtggaaaagagaaaacatttgcaaggattatccgagga
agctgctcagaatttcattttgatgataatcctgtgagtcgttctgcttatatagcagag
ttggaaaagataggtataatagtcaaagcacagaactgtctggtttttcagggaactgtg
gagtcaatttcaatgaaaaaacccaaagaaagaacccagttttttgaggaaatcagctct
tcaggagaccttataggtgaatatgaggaaaagaaaagaaagctacagaaagctgaagag
gatgcacagtttaattttaacaagaagaaaaatgtagctgcagagcgcaaacatgcaaaa
ttagagaaagaagaggcagaacgttaccagagtctccttgaagaactaaaaataaacaag
atagaactgcagcttttccaactatatcataatgagaaaaaaattcattttctgagcact
gagttagagcatatgaatagggacttgcgtgccacacaagagtctctttctcatcatgaa
aacattattaaagccaataaaaaggaacatggaatgctaactagacaactacaacaaaca
gaaaaagaaataaaatctcttgaagcacttttaaatcagaagaggcctcagtacattaaa
gcgaaagaaaacacatcttaccacctcaagaaattagatgtggctaagaaatcaataaag
gacagtgaaaaacaatgtgctaaacaggaagatgacattaaagccctagagacagagctg
gttgatttagatggtgcatggaagagttttgaaaagcagattgaggaagaagtcttacgt
aaagtgcgagacattgaattagaagccagtcagctggataattataaagaacttaaggaa
caagtaagaaagaaagtggctataatgacccaacaactggaaaaactacagtgggaacag
aaggctgataaagaaagattggcatttgaaaagaggaggcatgcagaagttaaggaaaat
ctaaaacaagtaaaagaacaaatagaagatcataaaaaacgaatagagaagttggaggag
tatacaaaaacgtgcatcgattgcttgaaagagaaaaaacagcaagaggaaaccctagtg
ggtgaaattgaaaaaacaaaatcaagaatttctgaaattaatgaagagatgactcttatc
ggaagtgagctgcagaatgccggcattgataaccatgaggggaaacgtgagaaaaagaga
gcagaagttctggaacacctgaaaagactctacccagattctgtgtttggaagactcctt
gacctatgtcatcctattcataagaaataccagctggctgttactaagctttttggccgg
tacatgattgccattgttgtaacctctgaaaaggtagcgagagactgtattcgatttctg
aaggaggaaagagctgagcctgagaccttccttgctctagattaccttgatattaagccc
atcaatgaaagattacgggagattaaaggctgtaaaatggtgattgatgtcataaagact
cagtttcctcagctgaagaaagtaattcagtttgtgtgtggaaatggccttgtctgtgaa
actgtggaagaagcaaggcacattgcattcaatggacctgaaagacggaaaacagtagct
cttgatggaacattatttttaaaatctggggtgatctctggagggtcaagtgacttaaaa
tacaaggctagatgctgggatgagaaagagttaaagaatttaagagacagaagaacccag
ctaacacaagaattaaaggatttaatgaagatgcttcgcaaagaagcagatttgaaacaa
atacagactctagtacaaggaactcatacacgactcaagtattcgcagagtgaactggag
attattaaaaagaagcaccttgctgctttttatcgggaacaatctcagctacaaagtgaa
ctactaaatattgagtctcaatgtactatgttgagtgaaggaatcaaaggacggcaacaa
agaattgaagaatttcaagaaaagatagataaggttgaagatgatatttttcaacacttc
tgtgaagaaattggcttggaaaatattcgtgaatttgagaaaagacatgttaaacagcaa
caagaaattgatcaaaaaagattagaatttgagaagcaaaaaactctgcttaatattcaa
ctcgaatatagtcgcaatcagctgaagaagaaactaaataagatcaacacgttaaaagaa
actatccagaaaggcagagaagacattgataacctaaagaaggctgaagaaaattgtctg
caagttgtggatgaactcatggtgaagtggcagcaacttaaggacatgtttgtcgctcag
aattccaacactgagaaaatccaagctcagattgaagaggaacggaggaagtttttggct
gttgatagggaagtgggaaaacggcagaaagaagttataatccttcagtcttctctggaa
cagaaacggctagagaagcataatctgctgcttgattgcaaagttcaagacattgaaata
actcttttgttggggtcactggacgacatcattgaagtagagttgggaactgaagcagag
agcacccaggcgacggttgatatatatgaaaaagaagaagccattgagatagactacagc
tctctacgagaggacttgaaggctctacagtctgacaaagaaatcgaagcccaccttaga
ctccttctgcaacatgtagcatcccaagaagatgtcctgttgaagacagcagcccccaac
ctgagagccctggagaacctgaagactgtcagagacaagtttcaggagtccacagatgct
tttgaggccagcagaaaggaagccagaatctgtaggcaagagtttgaacaggtgaaaaaa
aagagatacgatcttttcagccagtgttttgagcacgtctcagtctcaattgatcaaatc
tacaagaagctctgcagaaacaacagtgcccaagcatttcttagcccggagaacccagaa
gagccctacttggagggaattagctacaactgtgtggccccaggcaaacggttcatgcca
atggacaatttgtcggggggagaaaagtgtgtggcagccctggctctcctgtttgctgtg
cacagttttcggcctgctccattctttgttttagatgaagtggatgcagccctggacaac
actaacattggcaaagtatcaagttacatcaaagagcagactcaagaacagtttcagatg
ataatcatttccctaaaagaggagttctattccaaggccgacgccctgataggcatttat
ccagagcaagacgactgcatgttcagccgagttttgactctagatctttctcagtaccca
gacactgagggccaagagagcagcgagagaccacgagagtcccattag

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107506612
Entry
107506612         CDS       T06036                                 

Gene name
SMC1A
Definition
(RefSeq) structural maintenance of chromosomes protein 1A isoform X1
  KO
K06636  structural maintenance of chromosome 1
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04110  Cell cycle
ray04114  Oocyte meiosis
Brite
KEGG Orthology (KO) [BR:ray00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    107506612 (SMC1A)
   04114 Oocyte meiosis
    107506612 (SMC1A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ray03036]
    107506612 (SMC1A)
Chromosome and associated proteins [BR:ray03036]
 Eukaryotic type
  Sister chromatid cohesion proteins
   Cohesin complex
    107506612 (SMC1A)
  Meiosis-specific sister chromatid cohesion proteins
    107506612 (SMC1A)
SSDB
Motif
Pfam: SMC_N SMC_hinge AAA_21 AAA_23 AAA_15 AAA_29 ABC_tran SlyX SbcCD_C
Other DBs
NCBI-GeneID: 107506612
NCBI-ProteinID: XP_015992819
LinkDB
Position
Unknown
AA seq 1233 aa
MGFLKLIEIENFKSYKGRQIIGPFQRFTAIIGPNGSGKSNLMDAISFVLGEKTSNLRVKT
LRDLIHGAPVGKPAANRAFVSMVYSEEGAEDRTFARVIVGGSSEYKINNKVVQLHEYSEE
LEKLGILIKARNFLVFQGAVESIAMKNPKERTALFEEISRSGELAQEYDKRKKEMVKAEE
DTQFNYHRKKNIAAERKEAKQEKEEADRYQRLKDEVVRAQVQLQLFKLYHNEVEIEKLNK
ELASKNKEIEKDKKRMDKVEDELKEKKKELGKMMREQQQIEKEIKEKDSELNQKRPQYIK
AKENTSHKIKKLEAAKKSLQNAQKHYKKRKGDMDELEKEMLSVEKARQEFEERMEEESQS
QGRDLTLEENQVKKYHRLKEEASKRAATLAQELEKFNRDQKADQDRLDLEERKKVETEAK
IKQKLREIEENQKRIEKLEEYITTSKQSLEEQKKLEGELTEEVEMAKRRIDEINKELNQV
MEQLGDARIDRQESSRQQRKAEIMESIKRLYPGSVYGRLIDLCQPTQKKYQIAVTKVLGK
NMDAIIVDSEKTGRDCIQYIKEQRGEPETFLPLDYLEVKPTDEKLRELKGAKLVIDVIRY
EPPHIKKALQYACGNALVCDNVEDARRIAFGGHQRHKTVALDGTLFQKSGVISGGASDLK
AKARRWDEKAVDKLKEKKERLTEELKEQMKAKRKEAELRQVQSQAHGLQMRLKYSQSDLE
QTKTRHLALNLQEKSKLESELANFGPRINDIKRIIQSREREMKDLKEKMNQVEDEVFEEF
CREIGVRNIREFEEEKVKRQNEIAKKRLEFENQKTRLGIQLDFEKNQLKEDQDKVHMWEQ
TVKKDENEIEKLKKEEQRHMKIIDETMAQLQDLKNQHLAKKSEVNDKNHEMEEIRKKLGG
ANKEMTHLQKEVTAIETKLEQKRSDRHNLLQACKMQDIKLPLSKGTMDDISQEEGSSQGE
DSVSGSQRTSSIYAREALIEIDYGDLCEDLKDAQAEEEIKQEMNTLQQKLNEQQSVLQRI
AAPNMKAMEKLESVRDKFQETSDEFEAARKRAKKAKQAFEQIKKERFDRFNACFESVATN
IDEIYKALSRNSSAQAFLGPENPEEPYLDGINYNCVAPGKRFRPMDNLSGGEKTVAALAL
LFAIHSYKPAPFFVLDEIDAALDNTNIGKVANYIKEQSTCNFQAIVISLKEEFYTKAESL
IGVYPEQGDCVISKVLTFDLTKYPDANPNPNEQ
NT seq 3702 nt   +upstreamnt  +downstreamnt
atggggttcctgaaactgattgagatcgagaacttcaagtcgtacaagggtcgacagatt
atcggaccatttcagaggttcaccgccatcattggacccaatggctctggtaagtcaaat
ctcatggatgccatcagctttgtgttgggtgaaaaaaccagcaacctgcgggtaaagacc
ctgagggacctgatccatggagctcctgtgggcaagccagctgccaaccgggccttcgtc
agcatggtctactccgaggagggtgctgaggaccgcacctttgcccgtgtcattgttgga
ggttcctctgagtacaagatcaacaacaaagtggtccagctacatgagtacagtgaggaa
ttagagaagttgggcattctcatcaaagctcgtaacttccttgttttccagggcgctgtg
gaatctattgccatgaagaaccccaaagaaaggacagctctatttgaagaaatcagtcgc
tctggggagctagctcaggagtatgacaagcgaaagaaggaaatggtgaaagctgaagag
gacacacaatttaattaccatcgtaagaaaaacatcgcggcggaacgcaaggaagccaaa
caggagaaagaagaggctgaccgctaccagcgcctgaaggatgaggtggtgcgagctcag
gtacagcttcagctctttaagctttatcataatgaagtagaaatcgagaagctcaataag
gaactggcttctaagaacaaggagattgaaaaggacaagaagcgtatggacaaggtagag
gatgaactaaaggagaagaagaaggagctgggcaaaatgatgcgggaacagcagcagatt
gaaaaggaaatcaaggaaaaggattcagaactgaaccagaagcggcctcagtacatcaaa
gccaaggagaatacctcccacaaaatcaagaagttagaagcagccaagaaatccctacag
aatgctcagaagcattacaagaagcgtaaaggtgacatggatgagctggaaaaggagatg
ctgtcagtggaaaaggcccggcaggagtttgaggaacggatggaagaggagagtcagagt
cagggcagagacttgactctggaggagaatcaggtgaagaaataccaccggttgaaagaa
gaagccagcaagagagcggctaccctggctcaggagctggagaaattcaatcgagaccag
aaagctgaccaggaccggctggatttggaagagcggaagaaagtagaaacagaggccaag
atcaagcaaaagctgcgggagattgaagagaatcaaaagcggattgagaaactggaggag
tacatcacgactagcaagcagtctttagaggagcagaagaagctagaaggggagctgaca
gaggaggtggaaatggccaagcggcgtatcgatgagatcaacaaggagctgaaccaggtg
atggagcagcttggggatgcccgtattgaccgccaggagagcagccgccaacagcgaaag
gcagagattatggaaagcatcaagcgcctgtaccctggctctgtgtatggccgcctcatt
gacctgtgccagcccacacaaaagaagtatcagattgctgtaaccaaagttttgggtaag
aacatggatgccattattgtggactcagagaagacaggccgggattgtattcagtatatc
aaggagcagcgtggggagcctgagaccttcttgcctcttgactacctagaggtgaagcct
acagatgagaaactccgagagcttaagggggccaagcttgtgattgatgtgattcgatat
gagccacctcacatcaaaaaggccctgcagtatgcttgtggcaatgcccttgtctgtgac
aacgtggaggatgcccgtcgcattgcctttggaggccaccagcgccacaagacagtggca
ctggatgggactctgttccagaagtcaggagtgatctctggtggggccagtgacctgaag
gccaaggcgcggcgctgggatgagaaagcggtagacaagctaaaagagaagaaggagcgg
ttgacagaggagcttaaggagcagatgaaagcaaagcggaaagaggcagagctacgtcaa
gtgcagtctcaggcccacggactacagatgcggctcaaatactcacagagtgatctagaa
cagaccaagacacgacatctagccctgaatctgcaggaaaagtctaagctggagagtgag
ctagccaactttgggcctcgcatcaatgatatcaagaggatcatccagagccgggagagg
gaaatgaaagacttaaaggagaagatgaaccaggtagaggatgaagtgtttgaagaattt
tgtcgggagatcggtgtacgcaacatccgggagtttgaggaagagaaggtgaagcggcag
aatgaaattgccaagaagcgtttggaatttgagaatcagaagactcgcttgggtatccag
ctggattttgaaaagaaccaactgaaggaagatcaggataaagtacacatgtgggagcag
acagtgaaaaaggatgaaaatgagatagaaaagctcaagaaggaggaacaaagacacatg
aagatcatagatgagaccatggcccagctacaagatctgaagaatcagcacctggccaaa
aagtcagaggtgaatgacaagaatcatgagatggaggagattcgtaagaaactggggggc
gccaacaaggaaatgacccatttgcagaaggaggtaacagccattgagaccaagcttgaa
cagaagcgcagtgaccgccacaatctgctacaggcctgcaagatgcaggacatcaagttg
ccactctctaagggcaccatggatgatattagtcaggaagagggtagctcccagggggaa
gattcggtgagtggttcccagcgaacttccagtatctatgcacgagaggccctcatcgag
attgactacggtgacctgtgtgaggatctgaaggatgcccaggccgaggaggagatcaag
caggagatgaacacactgcagcagaagctaaatgagcagcagagtgtgctacagcgtatt
gctgcccccaacatgaaggccatggaaaaactggaaagtgtccgagacaagttccaggag
acctcagatgagtttgaagcggcccgaaagcgagccaagaaggccaagcaggcgtttgaa
cagatcaagaaggagcgctttgaccgcttcaatgcttgttttgaatctgtggccaccaac
attgatgagatctacaaggccctgtcccgcaacagcagtgcccaggcattcctgggccct
gaaaaccctgaagagccctacttggatggcatcaactacaactgtgtggcccctggcaaa
cgtttccggcctatggacaatttgtcagggggagagaaaacagtggcagctctggctctg
ctctttgccatccacagctacaagccagcccccttcttcgtcctggatgagattgacgct
gccctggataacaccaacattggcaaggttgccaattacattaaggagcagtcgacttgc
aacttccaggccatcgtcatctctctcaaggaggagttctacacaaaggctgagagcctc
attggagtctaccccgagcaaggggactgtgtgatcagcaaagtcctgacctttgatctc
accaagtatccagatgccaaccccaaccccaatgagcagtag

DBGET integrated database retrieval system