KEGG   Rousettus aegyptiacus (Egyptian rousette): 107505594
Entry
107505594         CDS       T06036                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: histone acetyltransferase p300-like
  KO
K04498  E1A/CREB-binding protein [EC:2.3.1.48]
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04024  cAMP signaling pathway
ray04066  HIF-1 signaling pathway
ray04068  FoxO signaling pathway
ray04110  Cell cycle
ray04310  Wnt signaling pathway
ray04330  Notch signaling pathway
ray04350  TGF-beta signaling pathway
ray04520  Adherens junction
ray04630  JAK-STAT signaling pathway
ray04720  Long-term potentiation
ray04916  Melanogenesis
ray04919  Thyroid hormone signaling pathway
ray04922  Glucagon signaling pathway
ray04935  Growth hormone synthesis, secretion and action
ray05016  Huntington disease
ray05152  Tuberculosis
ray05161  Hepatitis B
ray05164  Influenza A
ray05165  Human papillomavirus infection
ray05166  Human T-cell leukemia virus 1 infection
ray05167  Kaposi sarcoma-associated herpesvirus infection
ray05200  Pathways in cancer
ray05203  Viral carcinogenesis
ray05206  MicroRNAs in cancer
ray05211  Renal cell carcinoma
ray05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    107505594
   04330 Notch signaling pathway
    107505594
   04350 TGF-beta signaling pathway
    107505594
   04630 JAK-STAT signaling pathway
    107505594
   04066 HIF-1 signaling pathway
    107505594
   04068 FoxO signaling pathway
    107505594
   04024 cAMP signaling pathway
    107505594
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    107505594
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    107505594
 09150 Organismal Systems
  09152 Endocrine system
   04922 Glucagon signaling pathway
    107505594
   04935 Growth hormone synthesis, secretion and action
    107505594
   04919 Thyroid hormone signaling pathway
    107505594
   04916 Melanogenesis
    107505594
  09156 Nervous system
   04720 Long-term potentiation
    107505594
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107505594
   05206 MicroRNAs in cancer
    107505594
   05203 Viral carcinogenesis
    107505594
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    107505594
   05215 Prostate cancer
    107505594
  09164 Neurodegenerative disease
   05016 Huntington disease
    107505594
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    107505594
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    107505594
   05161 Hepatitis B
    107505594
   05164 Influenza A
    107505594
   05167 Kaposi sarcoma-associated herpesvirus infection
    107505594
   05165 Human papillomavirus infection
    107505594
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ray03000]
    107505594
   03036 Chromosome and associated proteins [BR:ray03036]
    107505594
   03029 Mitochondrial biogenesis [BR:ray03029]
    107505594
Enzymes [BR:ray01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     107505594
Transcription factors [BR:ray03000]
 Eukaryotic type
  Other transcription factors
   Pocket domain CBP
    107505594
Chromosome and associated proteins [BR:ray03036]
 Eukaryotic type
  Histone modification proteins
   HATs (histone acetyltransferases)
    107505594
Mitochondrial biogenesis [BR:ray03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Coactivators
    107505594
SSDB
Motif
Pfam: HAT_KAT11 Creb_binding DUF902 Bromodomain ZZ zf-TAZ Npa1
Other DBs
NCBI-GeneID: 107505594
NCBI-ProteinID: XP_015991339
LinkDB
Position
Unknown
AA seq 1276 aa
MEAKMEVDQPEPADTQPEDIPEIKTEDCKVEPIETEERGTELKTEIKEEEDQPSTSVTQS
SPAPGQSKKKIFKPEELRQALMPTLEALYRQDPESLPFRQPVDPQLLGIPDYFDIVKSPM
DLSTIKRKLDTGQYQEPWQYVDDIWLMFNNAWLYNRKTSRVYKYCSKLSEVFEQEIDPVM
QSLGYCCGRKLEFSPQTLCCYGKQLCTIPRDATYYSYQNRYHFCEKCFNEIQGESVSLGD
DPSQPQTTINKEQFSKRKNDTLDPELFVECTECGRKMHQICVLHHEVIWPSGFICDGCLK
KSARTRKENKFSAKRLPSTRLGTFLENRVNEFLRRQNHPESGEVTVRVVHASDKTVEVKP
GMKARFVDSGEMAESFPYRTKALFAFEEIDGVDLCFFGMHVQEYGSDCPPPNQRRVYISY
LDSVHFFHPKCLRTAVYHEILIGYLEYVKKLGYTTGHIWACPPSEGDDYIFHCHPPDQKI
PKPKQLQEWFKKMLDKAVSERIVHDYKDIFKQATEDRLTSAKELPYFEGDFWPNVLEESI
KELEQEEEERKREENTSNESTDVRVSGDLSQKLYATMERHKEVFFVIRLIAGPAANSLPP
IVDPDPLIPCDLMDGRDAFLTLARDKHLEFSSLRRAQWSTMCMLAELHIQSQDRFVYTCN
ECKHHVETRWHCTVCEDYDLCITCYNTKNHDHKMEKLGLGLDDESNSQQAAATQSPGDSR
RLSIKRCIQSLFHACQCRNANCSLPSCQKMKRVVQHNKGCKRKTNGGCHICKQLIALCCY
HAKHCQENKCPIPFCLNIKQKLRQQQLQHRRQQAQMLRRRMASMQRTGVAGQQQGLPSPT
LATPTTPTSQQPTTPQIPQPPPPPQPQPTPPNSMPPYLPMTQAAGPSSQGRAAGHVGVSP
LRPNTEPQQALQNLLRTLRSPSSPLQQQQVLSILHANPQLLAAFIKQRAAKYASSNPQSL
PGQPGMPQGQPGLQPPAMPGQQGVHSNPGMQNLNAMQAGVQRAGLPQQQPQQXLQPPVGG
MSPRAQQVNMNHNAMPSQFRDILRRQQMMQQQQGAGPGLGPGMANHTQFQQPQGVGYPPQ
QQQXQQQWMQHHMQQMQQGNMGPMGQLPQALGPEAGASLQVYQQRLLQQQMGSPAQPNPM
SPQQHMLPNQAQSPHLQGQQIPSSLSNQVRSPQPVPSPRPQSQPPHSSPSPRMQPQPSPH
HVSPQTSSPHPGLVAAQANPMDQGHFASPDQNSMLSQLASNPGMANLHGASATDLGLSTD
NSDLNSTLSQSTLDIH
NT seq 3831 nt   +upstreamnt  +downstreamnt
atggaggctaaaatggaagtggatcaaccagaaccagcagatactcagccagaggatatt
ccagagattaaaacagaagactgtaaagtggaacctatagaaacagaagagagaggcact
gaattaaaaactgaaataaaagaggaagaagaccagccaagtacttcagttacccagtcg
tctccagccccaggacagtcaaaaaagaagattttcaaaccggaggaattacgtcaggcg
ctgatgccaacgttggaggcactttaccgacaggatccggaatcccttccttttcgtcag
cctgtggaccctcagcttctaggaatccctgattacttcgatattgtgaagagccccatg
gatctttctaccatcaagaggaagttagacactggacagtatcaggaaccgtggcagtat
gtggacgacatctggcttatgttcaacaatgcctggctatataatcggaaaacgtcgcga
gtgtacaaatactgctccaagctgtctgaggtctttgaacaagaaattgacccagtcatg
caaagccttggatattgttgtggcagaaagttggagttctctccacagacactctgttgc
tatggcaaacagttatgcacaatccctcgtgatgccacttactacagttatcaaaacagg
tatcatttctgtgagaagtgtttcaatgaaatccaaggggagagcgtttctttgggggat
gacccttcccagcctcaaactacaataaataaagaacaattttccaagagaaaaaatgac
acactggatcctgaactatttgtggaatgtacagagtgtggaagaaagatgcatcagatc
tgtgtccttcatcatgaggtcatctggccatctgggtttatctgcgacggctgtttgaag
aagtctgcacgaactaggaaagaaaataaattttctgctaaaaggttgccatctaccagg
ctaggcacctttctggagaatcgcgtgaatgaatttctgaggcgacagaatcaccctgag
tcaggagaggtcactgttcgggtagttcatgcttctgacaaaaccgtggaagtcaaacca
ggcatgaaagcaaggtttgtagatagtggagagatggcagaatcctttccatatcgaacc
aaagccctctttgcctttgaagagatcgatggtgttgacttatgcttctttggcatgcat
gttcaagagtatggctcggactgccctccacccaatcagaggagagtatacatatcatac
ctcgatagtgttcatttcttccatcctaaatgcttgagaactgcggtctaccacgaaatt
ctgattggatatttagaatacgtcaagaaattaggttatacaacaggacatatttgggca
tgtcctccaagtgagggagatgactatatcttccattgtcatcctcctgaccagaagata
cccaagcctaagcaactgcaagaatggttcaaaaagatgcttgacaaggccgtgtctgag
cgaatcgtccatgactacaaggatatttttaaacaagctactgaagatcgattaacaagt
gccaaggaattgccttacttcgagggtgatttctggcccaatgtcctggaagagagcatt
aaggaactggaacaggaagaggaagagcggaaacgagaggaaaacaccagcaacgagagc
acagatgtcagggtttccggtgacctctcgcagaaactgtatgccaccatggagagacat
aaagaggttttctttgtgatccgtctcatcgctggccctgccgccaactccctgccgccc
atcgttgatcctgaccccctcatcccctgcgatctgatggatgggcgggacgccttcctc
accctcgcaagggacaagcacctggagttctcatcgctgcgaagagcccagtggtccacc
atgtgcatgctagcggagctgcacatccagagccaggaccgcttcgtctacacctgcaac
gagtgcaagcaccacgtggagacccgctggcactgcaccgtgtgcgaggattacgatttg
tgtatcacctgctataacactaaaaaccatgaccacaaaatggagaaactaggtcttggc
ttagatgacgaaagcaacagccagcaggctgcggccacccagagcccaggagactctcgc
cgcctgagcatcaagcgctgcatccagtccctgttccacgcctgccagtgccgaaatgcc
aactgctccctgccctcctgccagaagatgaagcgggttgtacagcacaacaaaggctgc
aaacggaaaaccaatggagggtgtcacatctgcaagcagctcatcgccctctgctgctac
catgccaagcactgccaggagaacaagtgccccatcccgttctgcctaaatatcaagcag
aaactccggcagcagcagctgcagcaccggcggcagcaggcacagatgctgcggaggagg
atggccagcatgcagcggaccggcgtggcggggcagcagcagggcctgccctcccccact
ctggccacgcccaccacgccaacgagccagcagcccaccaccccacagatacctcagccc
ccgccccctcctcagccccagcctacacctcccaacagcatgccgccgtacttgcccatg
actcaggctgctggccctagttcccagggtagggcagcaggccatgtaggtgtgagccct
ctcagaccaaacactgagcctcaacaagccttacaaaaccttttgcggactctcaggtct
cccagctctcccctacagcagcaacaggtgcttagtatccttcacgccaacccccagctg
ttggctgcattcatcaagcagcgggctgccaagtacgccagctctaatccacagtccctc
cctgggcagcctggcatgccccagggccagccagggctccagccccctgccatgccaggt
cagcagggggtccactccaatccaggcatgcagaacttgaatgccatgcaggcgggtgtc
cagagggccggcctgccccagcagcagccacagcagtaactgcagccacccgtgggaggg
atgagcccccgggctcagcaggtgaacatgaatcacaacgccatgccttcacagttccga
gacatcttgaggcgacagcagatgatgcagcagcagcagggcgcagggccaggccttggc
ccggggatggccaaccatacccagtttcagcagccccaaggagttggctaccctccacag
cagcagcagtagcagcagcagtggatgcagcatcatatgcagcagatgcagcaagggaac
atgggaccgatgggccagctcccccaggctctgggaccggaggcaggagccagtctgcag
gtctatcagcagcgactccttcagcaacagatggggtcccctgctcagcccaaccccatg
agcccccaacagcatatgctcccgaatcaggctcagtccccacacctacaaggccagcag
atcccttcttctctctccaatcaagtgcgttctccccagcctgtcccttctcctcggcca
cagtctcagcccccccactccagcccttccccaaggatgcaacctcaaccttctccacac
cacgtctccccgcagaccagttccccccatccgggactggtagctgcccaggccaacccc
atggatcaagggcactttgccagcccggaccagaattcgatgctttctcagctcgctagc
aacccaggcatggcaaacctccatggtgcaagcgccacggacctgggactcagcaccgac
aactcagacttgaattcaaccctctcacagagtacactagacatacactag

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107508087
Entry
107508087         CDS       T06036                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: histone acetyltransferase p300-like
  KO
K04498  E1A/CREB-binding protein [EC:2.3.1.48]
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04024  cAMP signaling pathway
ray04066  HIF-1 signaling pathway
ray04068  FoxO signaling pathway
ray04110  Cell cycle
ray04310  Wnt signaling pathway
ray04330  Notch signaling pathway
ray04350  TGF-beta signaling pathway
ray04520  Adherens junction
ray04630  JAK-STAT signaling pathway
ray04720  Long-term potentiation
ray04916  Melanogenesis
ray04919  Thyroid hormone signaling pathway
ray04922  Glucagon signaling pathway
ray04935  Growth hormone synthesis, secretion and action
ray05016  Huntington disease
ray05152  Tuberculosis
ray05161  Hepatitis B
ray05164  Influenza A
ray05165  Human papillomavirus infection
ray05166  Human T-cell leukemia virus 1 infection
ray05167  Kaposi sarcoma-associated herpesvirus infection
ray05200  Pathways in cancer
ray05203  Viral carcinogenesis
ray05206  MicroRNAs in cancer
ray05211  Renal cell carcinoma
ray05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    107508087
   04330 Notch signaling pathway
    107508087
   04350 TGF-beta signaling pathway
    107508087
   04630 JAK-STAT signaling pathway
    107508087
   04066 HIF-1 signaling pathway
    107508087
   04068 FoxO signaling pathway
    107508087
   04024 cAMP signaling pathway
    107508087
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    107508087
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    107508087
 09150 Organismal Systems
  09152 Endocrine system
   04922 Glucagon signaling pathway
    107508087
   04935 Growth hormone synthesis, secretion and action
    107508087
   04919 Thyroid hormone signaling pathway
    107508087
   04916 Melanogenesis
    107508087
  09156 Nervous system
   04720 Long-term potentiation
    107508087
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107508087
   05206 MicroRNAs in cancer
    107508087
   05203 Viral carcinogenesis
    107508087
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    107508087
   05215 Prostate cancer
    107508087
  09164 Neurodegenerative disease
   05016 Huntington disease
    107508087
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    107508087
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    107508087
   05161 Hepatitis B
    107508087
   05164 Influenza A
    107508087
   05167 Kaposi sarcoma-associated herpesvirus infection
    107508087
   05165 Human papillomavirus infection
    107508087
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ray03000]
    107508087
   03036 Chromosome and associated proteins [BR:ray03036]
    107508087
   03029 Mitochondrial biogenesis [BR:ray03029]
    107508087
Enzymes [BR:ray01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     107508087
Transcription factors [BR:ray03000]
 Eukaryotic type
  Other transcription factors
   Pocket domain CBP
    107508087
Chromosome and associated proteins [BR:ray03036]
 Eukaryotic type
  Histone modification proteins
   HATs (histone acetyltransferases)
    107508087
Mitochondrial biogenesis [BR:ray03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Coactivators
    107508087
SSDB
Motif
Pfam: HAT_KAT11 Creb_binding ZZ zf-TAZ Npa1
Other DBs
NCBI-GeneID: 107508087
NCBI-ProteinID: XP_015995106
LinkDB
Position
Unknown
AA seq 1121 aa
HEVDFVVYVIVYVSLKFCKQNLGLPFRFICDGCLKKSARTRKENKFSAKRLPSTRLGTFL
ENRVNEFLRRQNHPESGEVTVRVVHASDKTVEVKPGMKARFVDSGEMAXSFPYRTKALFA
FEEIDGVDLCXFGMHVQEYGSDCPPPNQRRVYISYLDSVHFFHPKCLRTAVYHEILIGYL
EYVKKLGYTTGHIWACPPSEGDDYIFHCHPPDQKIPSLSNXWFKKMLDKAVSERIVHDYK
DIFKQATEDRLTSAKELPYFEGDFWPNVLEESIKELAQMVTKGDSKNAKKKNNKKTSKNK
SSLSRGNKKKPGMPNVSNDLSQKLYATMEKHKEVFFVIRLIAGPAANSLPPIVDPDPLIP
CDLMDGRDAFLTLARDKHLEFSSLRRAQWSTMCMLVELHTQSQDRFVYTCNECKHHVETR
WHCTVCEDYDLCITCYNTKNHDHKMEKLGLGLDDESNSQQAAATQSPGDSRRLSIQRCIQ
SLFHACQCRNANCSLPSCQKMKRVVQHTKGCKRKTNGGCPICKQLIALCCYHAKHCQENK
CPVPFCLNIKQKLRQQQLQHRLQQAQMLRRRMASMQRTGVAGQQQGLPSPTLATPTTPEP
AETPQQPQPTPPNSMPPYLPRTQAAGPVSQGKAAGQVTPPAPPQTAQPPLPGPPPAAWQC
RFQLLARSSTRLMAXNPMARGPGGHLEPGMGPTGMQQQPPWAQGGLPQPQQLQTGMPRPA
MMSVAQHGQPLNMAPQPGLGQVGLKPGTVPQQALQNLLRTLRSPSSPLQQQQVLSILHAN
PQLLAAFIKQRAAKYANSNPQSLPGQPGMPQGQPGLQPPGMPGQQGVHSNPAMQNLNAMQ
AGVQRAGLPQQQPQQQLQPPVGGMSPQAQQVNMNHNAMPSQFRDILRRQQMMQQQQQQGA
GPGLGPGMANHTQFQQPQGVGYPPQQQQQQQQRMQHHMQQMQQGNMGPMGQLPQALGPEA
GASLQVYQQRLLQQQMGSPAQPNPMSPQQHMLPNQAQSPHLQGQQIPSSLSNQVRSPQPV
PSPRPQSQPPHSSPSPRMQPQPSPHHVSPQTSSPHPGLVAAQANPMDQGHFASPDQNSML
SQLASNPGMANLHGASATDLGLSTDNSDLNSTLSQSTLDIH
NT seq 3366 nt   +upstreamnt  +downstreamnt
catgaggtagattttgtagtgtacgttattgtgtatgtttctcttaagttttgtaagcag
aatcttggtttaccttttaggtttatctgcgacggctgtttgaagaagtctgcacgaact
aggaaagaaaataaattttctgctaaaaggttgccatctaccaggctaggcacctttctg
gagaatcgcgtgaatgaatttctgaggcgacagaatcaccctgagtcaggagaggtcact
gttcgggtagttcatgcttctgacaaaaccgtggaagtcaaaccaggcatgaaagcaagg
tttgtagatagtggagagatggcangatcctttccatatcgaaccaaagccctctttgcc
tttgaagagatcgatggtgttgacttatgcntctttggcatgcatgttcaagagtatggc
tcggactgccctccacccaatcagaggagagtatacatatcatacctcgatagtgttcat
ttcttccatcctaaatgcttgagaactgcggtctaccacgaaattctgattggatattta
gaatacgtcaagaaattaggttatacaacaggacatatttgggcatgtcctccaagtgag
ggagatgactatatcttccattgtcatcctcctgaccagaagataccaagcctaagcaac
taatggttcaaaaagatgcttgacaaggccgtgtctgagcgaatcgtccatgactacaag
gatatttttaaacaagctactgaagatcgattaacaagtgccaaggaattgccttacttc
gagggtgatttctggcccaatgtcctggaagagagcattaaggaactagcacagatggtg
acaaaaggagacagcaaaaatgctaaaaagaaaaataataagaaaaccagcaaaaacaag
agcagcctaagtaggggcaataagaagaagccaggcatgcccaatgtttccaatgacctc
tcgcagaaactgtatgccaccatggagaagcataaagaggttttctttgtgatccgtctc
atcgctggccctgccgccaactccctgccgcccatcgttgatcctgaccccctcatcccc
tgcgatctgatggatgggcgggacgccttcctcaccctcgcaagggacaagcacctggag
ttctcatcgctgcgaagagcccagtggtccaccatgtgcatgctagtggagctgcacacc
cagagccaggaccgcttcgtctacacctgcaacgagtgcaagcaccacgtggagacccgc
tggcactgcaccgtgtgcgaggattacgatttgtgtatcacctgctataacactaaaaac
catgaccacaaaatggagaaactaggtcttggcttagatgacgaaagcaacagccagcag
gctgcggccacccagagcccaggagactctcgccgcctgagcatccagcgctgcatccag
tccctgttccacgcctgccagtgccgaaatgccaactgctccctgccctcctgccagaag
atgaagcgggttgtacagcacaccaaaggttgcaaacggaaaaccaatggagggtgcccc
atttgcaaacagctcatcgccctctgctgctaccatgccaagcactgccaggagaacaag
tgccccgtcccgttctgcctaaatatcaagcagaaactccggcagcagcagctgcagcac
cggctgcagcaggcacagatgctgcggaggaggatggccagcatgcagcggaccggcgtg
gcggggcagcagcagggcctgccctcccccactctggccacgcccaccacgcccgagcca
gcagagacacctcagcagccccagcctacacctcccaacagcatgccgccgtacttgccc
aggactcaagctgctggccctgtgtcccagggtaaggcagcaggccaggtgacccctcca
gcgccccctcagaccgctcagccaccccttccagggccaccacctgcagcatggcaatgc
agattccagctacttgcccgatccagcaccagactcatggctnngaatcccatggccaga
ggtcctggtgggcatttggagccagggatggggcccaccgggatgcaacagcagccaccg
tgggcccaaggaggattgcctcagccccagcaactacagaccgggatgcccaggccagcc
atgatgtcagtggcccaacatggtcagcccttgaacatggctccccagccaggactgggc
caggtaggtctcaaaccaggcactgtgcctcaacaagccttacaaaaccttttgcggact
ctcaggtctcccagctctcccctacagcagcaacaggtgcttagtatccttcacgccaac
ccccagctgttggctgcattcatcaagcagcgggctgccaagtacgccaactctaatcca
cagtccctccctgggcagcctggcatgccccagggccagccagggctccagccccctggc
atgccaggtcagcagggggtccactccaatccagccatgcagaacttgaatgccatgcag
gcgggtgtccagagggccggcctgccccagcagcagccacagcagcaactgcagccaccc
gtgggagggatgagcccccaggctcagcaggtgaacatgaatcacaacgccatgccttca
cagttccgagacatcttgaggcgacagcagatgatgcagcagcagcagcagcagggcgca
gggccaggccttggcccggggatggccaaccatacccagtttcagcagccccaaggagtt
ggctaccccccgcagcagcagcagcagcagcagcagcggatgcagcatcatatgcagcag
atgcagcaagggaacatgggaccgatgggccagctcccccaggctctgggaccggaggca
ggagccagtctgcaggtctatcagcagcgactccttcagcaacagatggggtcccctgct
cagcccaaccccatgagcccccaacagcatatgctcccgaatcaggctcagtccccacac
ctacaaggccagcagatcccttcttctctctccaatcaagtgcgttctccccagcctgtc
ccttctcctcggccacagtctcagcccccccactccagcccttccccaaggatgcaacct
caaccttctccacaccacgtctccccgcagaccagttccccccatccgggactggtagct
gcccaggccaaccccatggatcaagggcactttgccagcccggaccagaattcgatgctt
tctcagctcgctagcaacccaggcatggcaaacctccatggtgcaagcgccacggacctg
ggactcagcaccgacaactcagacttgaattcaaccctctcacagagtacactagacata
cactag

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107519708
Entry
107519708         CDS       T06036                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: histone acetyltransferase p300-like
  KO
K04498  E1A/CREB-binding protein [EC:2.3.1.48]
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04024  cAMP signaling pathway
ray04066  HIF-1 signaling pathway
ray04068  FoxO signaling pathway
ray04110  Cell cycle
ray04310  Wnt signaling pathway
ray04330  Notch signaling pathway
ray04350  TGF-beta signaling pathway
ray04520  Adherens junction
ray04630  JAK-STAT signaling pathway
ray04720  Long-term potentiation
ray04916  Melanogenesis
ray04919  Thyroid hormone signaling pathway
ray04922  Glucagon signaling pathway
ray04935  Growth hormone synthesis, secretion and action
ray05016  Huntington disease
ray05152  Tuberculosis
ray05161  Hepatitis B
ray05164  Influenza A
ray05165  Human papillomavirus infection
ray05166  Human T-cell leukemia virus 1 infection
ray05167  Kaposi sarcoma-associated herpesvirus infection
ray05200  Pathways in cancer
ray05203  Viral carcinogenesis
ray05206  MicroRNAs in cancer
ray05211  Renal cell carcinoma
ray05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    107519708
   04330 Notch signaling pathway
    107519708
   04350 TGF-beta signaling pathway
    107519708
   04630 JAK-STAT signaling pathway
    107519708
   04066 HIF-1 signaling pathway
    107519708
   04068 FoxO signaling pathway
    107519708
   04024 cAMP signaling pathway
    107519708
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    107519708
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    107519708
 09150 Organismal Systems
  09152 Endocrine system
   04922 Glucagon signaling pathway
    107519708
   04935 Growth hormone synthesis, secretion and action
    107519708
   04919 Thyroid hormone signaling pathway
    107519708
   04916 Melanogenesis
    107519708
  09156 Nervous system
   04720 Long-term potentiation
    107519708
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107519708
   05206 MicroRNAs in cancer
    107519708
   05203 Viral carcinogenesis
    107519708
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    107519708
   05215 Prostate cancer
    107519708
  09164 Neurodegenerative disease
   05016 Huntington disease
    107519708
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    107519708
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    107519708
   05161 Hepatitis B
    107519708
   05164 Influenza A
    107519708
   05167 Kaposi sarcoma-associated herpesvirus infection
    107519708
   05165 Human papillomavirus infection
    107519708
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ray03000]
    107519708
   03036 Chromosome and associated proteins [BR:ray03036]
    107519708
   03029 Mitochondrial biogenesis [BR:ray03029]
    107519708
Enzymes [BR:ray01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     107519708
Transcription factors [BR:ray03000]
 Eukaryotic type
  Other transcription factors
   Pocket domain CBP
    107519708
Chromosome and associated proteins [BR:ray03036]
 Eukaryotic type
  Histone modification proteins
   HATs (histone acetyltransferases)
    107519708
Mitochondrial biogenesis [BR:ray03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Coactivators
    107519708
SSDB
Motif
Pfam: KIX DUF902 zf-TAZ Bromodomain KIX_2
Other DBs
NCBI-GeneID: 107519708
NCBI-ProteinID: XP_016018142
LinkDB
Position
Unknown
AA seq 1259 aa
MAENVVEPGPPSAKRPKLSSPALSASASDGTDFGSLFDLEHDLPDELINSTELGLTNGGD
ISQLQTSLGIVQDAASKHKQLSELLRSGSSPNLNMGVGGPGQGMASQAQQNSPGLGLINS
MVKSPIPNMGMGTSGPNQGPTPAATGMMNSPVNQPAMGMNTGMNAGMNPGMLTAGNGQGM
MPNQVMNGSIGAGRGRPNMQYPNPGMGNAGNLMTEPLQQGSPQMGGQTGLRGPQPLKMGM
MNNPNPYGSPYTQNSGQQIGASGLGLQIQSKTVLPNSLSPFAMDKKAVPGGGMPSMGQQQ
APQVQQPGLVTPVSQGMGSGAHTADPEKRKLIQQQLVLLLHAHKCQRREQANGEVRQCNL
PHCRTMKNVLNHMTHCQSGKSCQVAHCASSRQIISHWKNCTRHDCPVCLPLKNAGDKRNQ
QSILTGAPVGLGNTSSLGVGQQSTPSLSTVSQIDPSSIERAYAALGLPYQVNQMQTQPPV
QAKNQQNQQSGQSPQGMRPMGNMNASPMGVNGGVGVQTSNLLSDSMLHSAINSQNPLMSE
NASVASLGPMPTAAQPSSSGIRKQWHEDITQDLRNHLVHKLVQAIFPTPDPAALKDRRME
NLVAYARKVEGDMYESANNRAEYYHLLAEKIYKIQKELEEKRRTRLQKQNMLPNAAGMVP
VSMNPGPNMGQPQPGMTSNGPLPDPSMIRGSVPNQMMPRAPPQPGLNQFGQIGMPQPPIG
PRQTSPLQHHGQLAQPGTLNPPLGYGPRIQQPSNPNQFLPQTPFPAQGMNVTNMPLAPSG
GQAPVSQAQMSSVSCPVNSPIMPPGSQGSHIHCPPLPQALHQNSPSPVPSRTPTPHHTPP
SIGAQQPPATVIPAPVPTPPAIPPGPQSQALHPPPRQTPTPPTTQLPPQAQPSLPAAASA
DQPQQQPLSQQSTGASVPTPTAPLLPPQPATPLSQPAVSIEGQVSNPPSTSSTEVNSQTI
AEKQPSQEVKMEAKMEVDQPEPADTQPEDIPEIKTEDCKVEPIDXESTEKTEIKEEEDQP
STSVTQSSPAPGQSKKKIFKPEELRQALMPTLEALYRQDPESLPFRQPVDPQLLGIPDYF
DIVKSPMDLSTIKRKLDTGQYQEPWQYVDDIWLMFNNAWLYNRKTSRVYKYCSKLSEVFE
QEIDPVMQSLGYCCGRKLEFSPQTLCCYGKQLCTIPRDATYYSYQNRYHFCEKCFNEIQG
ESVSLGDDPSQPQTTINKEQFSKRKNDTLDPELFVECTECGRKMHQICVLHHEVIWPSG
NT seq 3780 nt   +upstreamnt  +downstreamnt
atggccgagaatgtggtggaaccggggccgccttcagccaagcggcctaaactctcatct
ccggccctttcggcgtcggccagcgatggcacagattttggctctctgtttgacttggag
cacgacttaccagatgaattaatcaactctacagaattgggactaaccaatggtggtgat
attagtcagcttcagacaagtcttggcatagtacaagatgcagcctctaaacataaacaa
ctgtcagaattgctacggtctggtagttcccccaacctcaatatgggggttggtggccca
ggccaaggcatggccagccaggcccaacaaaacagtcctggattaggtttgataaatagc
atggtcaaaagcccaattcccaacatgggcatgggcacgagtggaccaaatcagggtccc
acgccggctgcaacaggtatgatgaacagtcccgtaaatcaacctgccatgggcatgaac
acagggatgaatgctggcatgaatcctggaatgttgactgcaggcaatggacaggggatg
atgcctaatcaagttatgaacggttcaattggagcgggccgggggcgacctaacatgcag
tacccaaacccaggcatgggaaatgctggcaacttaatgactgagccactgcagcagggc
tctccccagatgggaggacaaacaggattgagaggcccccagcctcttaagatgggaatg
atgaacaaccctaatccgtacggttcaccatacactcagaattctgggcagcagattgga
gctagtgggcttggtctccagattcagtcgaagactgtgctaccaaatagcttatctcca
tttgcaatggacaaaaaggcggttcctggtggaggaatgcccagcatgggccaacagcag
gcccctcaggtccagcagcctggccttgtgactccagtttcccaagggatgggttctgga
gcgcacacggctgatccagagaagcgcaaactcatccagcagcagctcgttctccttttg
catgcccacaagtgccagcgccgggagcaggctaatggggaagtgaggcagtgcaacctt
ccccactgtcgcacaatgaagaacgtcctaaaccacatgacacactgccagtcaggcaaa
tcctgccaagtggcacactgtgcatcttctcgacaaatcatttcacactggaagaactgt
acaagacacgattgtcctgtgtgtctccccctaaaaaatgctggggataagagaaatcaa
cagtcaattttaactggagcaccagttggacttggaaatactagctctctaggggtgggt
caacagtctacccccagcctaagcactgttagtcagattgatcccagctctatagaaaga
gcctatgcagctcttggactaccttatcaagtaaatcagatgcagacacagccccctgta
caagcaaaaaaccagcagaatcagcagtccggacagtctccccaaggcatgcgacctatg
ggcaacatgaatgctagtcctatgggagtaaatggaggtgtaggggttcaaacatccaat
cttctttccgactcaatgttgcattcagccataaattctcaaaacccattgatgagtgaa
aatgccagtgtggcctccctgggtcctatgccaacagcagctcaaccatccagcagtgga
attcggaaacaatggcatgaagatattactcaggatcttcgaaatcatcttgttcacaaa
cttgttcaagccatatttcctactccggatcctgctgctttaaaagacagacggatggaa
aacctagttgcatatgcccggaaggtggaaggggacatgtatgaatctgcaaataatcga
gctgaatattaccacctgctagctgagaagatctataaaatccagaaagaactagaagaa
aaacgaaggactagactacaaaaacaaaacatgctaccaaacgctgcaggcatggtgcca
gtttccatgaatccagggcctaacatggggcagccacaaccaggaatgacttctaatggc
cctcttcctgatccatctatgatccgtggcagtgtgccaaaccagatgatgcctcgggca
ccaccacaacctggtttgaatcaatttggccagataggtatgcctcagccccctattgga
ccacggcaaacctcacctcttcagcaccatggacagttggctcagcctgggactctcaac
cctcctctgggctatggacctcgcatacagcagccttccaacccgaaccagttccttccc
cagactccgttcccagcgcagggaatgaatgtaacgaatatgcctttggctccgtctggc
ggtcaagcaccagtgtctcaagcacaaatgtccagtgtttcctgccctgtgaactctcct
ataatgcctccagggtctcaagggagccacattcactgtcctcctctccctcaagctcta
catcagaattcaccctctcctgtacctagtcgtacccccacccctcaccacactccccca
agcataggggctcagcagccaccagcaacggtaattccagcccctgtccctacacctcca
gctataccacctgggccacagtcccaggctctgcatccaccgccaaggcagacaccaact
ccaccaacaacgcaacttcctccccaagcacagccttcacttcctgctgctgcttccgct
gaccagccacagcagcagcctctctctcagcagagtacaggagcatctgttcccaccccg
acggcaccactgctgcctccacagcctgcgacgccactttcccagccagctgtaagcatt
gaagggcaggtatccaatcctccatctactagtagcacagaagtgaattctcagaccatt
gctgagaagcagccttcacaggaagtgaaaatggaggctaaaatggaagtggatcaacca
gaaccagcagatactcagccagaggatattccagagattaaaacagaagactgtaaagtg
gaacctatagacnnagagagcactgaaaaaactgaaataaaagaggaagaagaccagcca
agtacttcagttacccagtcgtctccagccccaggacagtcaaaaaagaagattttcaaa
ccggaggaattacgtcaggcgctgatgccaacgttggaggcactttaccgacaggatccg
gaatcccttccttttcgtcagcctgtggaccctcagcttctaggaatccctgattacttc
gatattgtgaagagccccatggatctttctaccatcaagaggaagttagacactggacag
tatcaggaaccgtggcagtatgtggacgacatctggcttatgttcaacaatgcctggcta
tataatcggaaaacgtcgcgagtgtacaaatactgctccaagctgtctgaggtctttgaa
caagaaattgacccagtcatgcaaagccttggatattgttgtggcagaaagttggagttc
tctccacagacactctgttgctatggcaaacagttatgcacaatccctcgtgatgccact
tactacagttatcaaaacaggtatcatttctgtgagaagtgtttcaatgaaatccaaggg
gagagcgtttctttgggggatgacccttcccagcctcaaactacaataaataaagaacaa
ttttccaagagaaaaaatgacacactggatcctgaactatttgtggaatgtacagagtgt
ggaagaaagatgcatcagatctgtgtccttcatcatgaggtcatctggccatctgggtaa

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107521673
Entry
107521673         CDS       T06036                                 

Gene name
CREBBP
Definition
(RefSeq) CREB-binding protein
  KO
K04498  E1A/CREB-binding protein [EC:2.3.1.48]
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04024  cAMP signaling pathway
ray04066  HIF-1 signaling pathway
ray04068  FoxO signaling pathway
ray04110  Cell cycle
ray04310  Wnt signaling pathway
ray04330  Notch signaling pathway
ray04350  TGF-beta signaling pathway
ray04520  Adherens junction
ray04630  JAK-STAT signaling pathway
ray04720  Long-term potentiation
ray04916  Melanogenesis
ray04919  Thyroid hormone signaling pathway
ray04922  Glucagon signaling pathway
ray04935  Growth hormone synthesis, secretion and action
ray05016  Huntington disease
ray05152  Tuberculosis
ray05161  Hepatitis B
ray05164  Influenza A
ray05165  Human papillomavirus infection
ray05166  Human T-cell leukemia virus 1 infection
ray05167  Kaposi sarcoma-associated herpesvirus infection
ray05200  Pathways in cancer
ray05203  Viral carcinogenesis
ray05206  MicroRNAs in cancer
ray05211  Renal cell carcinoma
ray05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    107521673 (CREBBP)
   04330 Notch signaling pathway
    107521673 (CREBBP)
   04350 TGF-beta signaling pathway
    107521673 (CREBBP)
   04630 JAK-STAT signaling pathway
    107521673 (CREBBP)
   04066 HIF-1 signaling pathway
    107521673 (CREBBP)
   04068 FoxO signaling pathway
    107521673 (CREBBP)
   04024 cAMP signaling pathway
    107521673 (CREBBP)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    107521673 (CREBBP)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    107521673 (CREBBP)
 09150 Organismal Systems
  09152 Endocrine system
   04922 Glucagon signaling pathway
    107521673 (CREBBP)
   04935 Growth hormone synthesis, secretion and action
    107521673 (CREBBP)
   04919 Thyroid hormone signaling pathway
    107521673 (CREBBP)
   04916 Melanogenesis
    107521673 (CREBBP)
  09156 Nervous system
   04720 Long-term potentiation
    107521673 (CREBBP)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107521673 (CREBBP)
   05206 MicroRNAs in cancer
    107521673 (CREBBP)
   05203 Viral carcinogenesis
    107521673 (CREBBP)
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    107521673 (CREBBP)
   05215 Prostate cancer
    107521673 (CREBBP)
  09164 Neurodegenerative disease
   05016 Huntington disease
    107521673 (CREBBP)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    107521673 (CREBBP)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    107521673 (CREBBP)
   05161 Hepatitis B
    107521673 (CREBBP)
   05164 Influenza A
    107521673 (CREBBP)
   05167 Kaposi sarcoma-associated herpesvirus infection
    107521673 (CREBBP)
   05165 Human papillomavirus infection
    107521673 (CREBBP)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ray03000]
    107521673 (CREBBP)
   03036 Chromosome and associated proteins [BR:ray03036]
    107521673 (CREBBP)
   03029 Mitochondrial biogenesis [BR:ray03029]
    107521673 (CREBBP)
Enzymes [BR:ray01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     107521673 (CREBBP)
Transcription factors [BR:ray03000]
 Eukaryotic type
  Other transcription factors
   Pocket domain CBP
    107521673 (CREBBP)
Chromosome and associated proteins [BR:ray03036]
 Eukaryotic type
  Histone modification proteins
   HATs (histone acetyltransferases)
    107521673 (CREBBP)
Mitochondrial biogenesis [BR:ray03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Coactivators
    107521673 (CREBBP)
SSDB
Motif
Pfam: HAT_KAT11 KIX Creb_binding zf-TAZ DUF902 Bromodomain ZZ KIX_2 Npa1
Other DBs
NCBI-GeneID: 107521673
NCBI-ProteinID: XP_016022065
LinkDB
Position
Unknown
AA seq 2434 aa
MAENLLDGPPNPKRAKLSSPGFSANDSTDFGSLFDLENDLPDELIPNGELGLLNSGNLVP
DAASKHKQLSELLRGGSGSSINPGIGNVSASSPVQQGLGGQAQGQPNNANMASLGAMGKS
PLNQGDSSASSLPKQAASTSGPTPPASQPLNPQAQKQVGLVTSSPATSQTGPGICMNANF
NQTHPGLLNSNSGHSLMNQAQQGQAQVMNGSLGAAGRGRGAGMPYPAPAMQGTTSSVLAE
TLTQVSPQIPSHAGLNTAQAGGMTKMGMTGNTSPFGQPFSQTGGQPMGAPGVNPQLPSKQ
NVVTSLPPFPADIKNASVTNVPNMSQMQTSVGIVPTQAIATGPTADPEKRKLIQQQLVLL
LHAHKCQRREQANGEVRACSLPHCRTMKNVLNHMTHCQAGKACQVAHCASSRQIISHWKN
CTRHDCPVCLPLKNASDKRNQQTILGSPASGIQNTIGSVGTGQQNATSLSNPNPIDPSSM
QRAYAALGLPYLNQSQTQLQTQVPGQQPAQPPAHQQMRTLNPLGNNPMNIPAGGITTDQQ
PPNLISESALPTSLGATNPLMNDGSNSGNIGTLSTIPTAAPPSNTGVRKGWHEHVTQDLR
SHLVHKLVQAIFPTPDPAALKDRRMENLVAYAKKVEGDMYESANSRDEYYHLLAEKIYKI
QKELEEKRRSRLHKQGILGNQPALPAPGAQPPGIPQPQPVRPPNGPMPLPVNRMQGINSF
NPMSLGNVQLPQAPMGPRAASPMNHSVPMNSMGSVPGMAISPSRMPQPPNMMGAHANNMM
AQAPAQNQFLPQNQFPSSSGAMSVNSVGMGQPAAQTGVSQGQVPGAALPNPLNMLGPQAS
QLPCPPVTQSPLHQTPPPASTAAGMPSLQHPTAPGMTPPQPAAPTQPSTPVSSSGQTPTP
TPGSVPSASQAQSTPTVQAAAQVTPQPQTPVQPPSVATPQSSQQQPTPVHTQPPGTPLSQ
AAASIDNRVPTPSSVASAETSSQQPGPDVPMLEMKAEVKTEDIEPDASEPKAEPGSAMIE
EDLQGSSQVKEESDTTEQKSEPMEVDEKKPEVKVEAKEEEENVTNGAASQSASPSQPRKK
IFKPEELRQALMPTLEALYRQDPESLPFRQPVDPQLLGIPDYFDIVKNPMDLSTIKRKLD
TGQYQEPWQYVDDVWLMFNNAWLYNRKTSRVYKFCSKLAEVFEQEIDPVMQSLGYCCGRK
YEFSPQTLCCYGKQLCTIPRDAAYYSYQNRYHFCEKCFTEIQGENVTLGDDPSQPQTTIS
KDQFEKKKNDTLDPEPFVDCKECGRKMHQICVLHYDIIWPSGFVCDNCLKKTGRTRKENK
FSAKRLQTTRLGNHLEDRVNKFLRRQNHPEAGEVFVRVVASSDKTVEVKPGMKSRFVDSG
EMSESFPYRTKALFAFEEIDGVDVCFFGMHVQEYGSDCPPPNTRRVYISYLDSIHFFRPR
CLRTAVYHEILIGYLEYVKKLGYVTGHIWACPPSEGDDYIFHCHPPDQKIPKPKRLQEWY
KKMLDKAFAERIIHDYKDIFKQATEDRLTSAKELPYFEGDFWPNVLEESIKELEQEEEER
KKEESTAASETTEGSQGDSKNAKKKNNKKTNKNKSSISRANKKKPSMPNVSNDLSQKLYA
TMEKHKEVFFVIHLHAGPVINTLPPIVDPDPLLSCDLMDGRDAFLTLARDKHWEFSSLRR
SKWSTLCMLVELHTQGQDRFVYTCNECKHHVETRWHCTVCEDYDLCINCYNTKSHTHKMV
KWGLGLDDEGGSQGEPQSKSPQESRRLSIQRCIQSLVHACQCRNANCSLPSCQKMKRVVQ
HTKGCKRKTNGGCPVCKQLIALCCYHAKHCQENKCPVPFCLNIKHKLRQQQIQHRLQQAQ
LMRRRMATMNTRNVPQQSLPSPTSAPPGTPTQQPSTPQTPQPPTQPQPSPVSMSPAGFPS
VARTQPPTTVSTGKPTNQVPAPPPPAQPPPAAVEAARQIEREAQQQQHLYRVNINNGMPP
GRTGMVTPVSQMAPVGLNVPRPNQVSGPVMPNLPPGQWQQAPIPQQQPMPGMPRPVMSMQ
AQPTVAGPRMPNVQPPRSISPGALQDLLRTLKSPSSPQQQQQVLNILKSNPQLMAAFIKQ
RTAKYVASQPGLQPQPSLQAQPGLQPQPGLHQQPGLQNLNAMQGGGPRPGVPPQQQPMGG
LNPQGQALNIMNPGHNPSMASMNPQYREMLRRQLLQQQQQQQQQQQQQQGSAGMAAGMAG
HGQFQQPQGPGGYPPAMQQQRMQQHLPMQGSSMGQMAAQMGQLSQMGQPGLGADSTPNIQ
QALQQRILQQQQMKQQIGSPGQPNPMSPQQHMLSGQPQASHLPGQQMATSLSSQVRSPAP
VQSPRPQSQPPHSSPSPRIQPQPSPHHVSPQTGSPHPGLAVTMASSIDQGHLGNPEQSAM
LPQLNTPNRSALSNELSLVGDTTGDTLEKFVEGL
NT seq 7305 nt   +upstreamnt  +downstreamnt
atggccgagaacttgctggacggaccgcccaaccccaaacgagccaaacttagctcgccc
ggcttctcggcgaatgacagcacagattttggatcattgtttgacttggaaaatgatctt
cctgatgagctgatccccaatggagaattaggccttttaaacagtgggaaccttgttcca
gatgctgcttccaaacataaacaactgtcagagcttctgcgtggaggcagtggctctagt
atcaacccaggaataggaaatgtgagtgccagcagcccagtgcagcaaggccttggtggc
caggctcaagggcagccgaacaatgcgaatatggccagcctgggcgccatgggcaagagc
cctctgaaccaaggagattcttcagcctccagcctgcccaaacaggcagccagcacctct
gggcccactccccctgcttcccaaccactgaatccgcaagcacaaaagcaagtggggctg
gtgaccagcagccctgccacgtcgcagactggacctgggatctgcatgaatgctaacttt
aaccagacccacccaggcctccttaatagtaactcgggccatagtttaatgaaccaggcc
cagcaggggcaggcgcaagtcatgaatggatctctgggggctgctggcagaggaagggga
gctgggatgccgtaccctgctccagccatgcaggggaccacgagcagcgtgctggccgag
acgttaacacaggtttcaccgcaaattcccagtcacgcaggactgaacacggcacaggcg
ggaggcatgaccaagatgggaatgactggtaacacaagtccctttggacaaccctttagt
caaactggagggcagccaatgggagcccccggagtgaaccctcagttacccagcaaacag
aacgtggtcactagtttgcctcccttccctgcagacatcaagaatgcttcagttaccaac
gtgccaaacatgtctcagatgcaaacatcagtgggaattgtacccacacaagcaattgca
acgggccccactgcagatccagaaaaacgcaaactgatacagcagcagctggttctactg
cttcacgctcataaatgtcagagacgagaacaagcaaatggagaggttcgggcctgctcg
ctcccacattgccgaaccatgaaaaatgttttgaatcacatgacacattgtcaggctggg
aaagcctgtcaagttgcccattgtgcatcttcacgacaaatcatctctcattggaagaac
tgcacacgacatgactgtcctgtttgcctccctttgaaaaatgccagtgacaagcgaaac
caacaaaccatcctggggtctccagctagtggaattcagaacacaattggttctgttggt
acaggccagcagaatgccacttctttaagtaacccaaatcctatagaccccagctccatg
cagcgagcatatgctgctcttggactcccctacctgaaccagtctcagacgcagctgcag
actcaggttcccggtcagcaaccagcacagcctccagctcaccagcagatgaggactctc
aaccccctgggaaataacccaatgaacattccagcaggaggaataacaacagatcagcag
ccaccaaacttgatttcagaatcagctcttccaacctctcttggagccacaaacccactg
atgaatgatggctccaactctggaaacatcggaaccctcagcactatacctacagcagca
cctccttctaatactggcgttcggaaaggctggcatgaacatgtcacacaggacctgcgg
agccatctagtgcataaactcgtccaagccatcttcccaacacccgaccctgcagctctg
aaggatcgccgcatggagaacctagtggcctacgctaagaaagtagaaggggacatgtat
gagtctgccaacagccgggatgaatactatcacttattagcagagaaaatctacaagata
caaaaagagctagaagaaaaacgaagatcacgtttacacaaacaaggcatcttgggtaac
cagccagccttaccagccccaggggcacagccccctgggattccacagccacaacctgtg
agacctccaaatggacccatgcccctgccagtgaatcgtatgcaagggataaattcattt
aacccgatgtccttggggaatgtacagttgccacaagctcccatgggaccgcgcgcagca
tcccccatgaaccactctgtcccaatgaacagcatgggctccgttccagggatggccatt
tctccttcccgaatgcctcagcctccaaacatgatgggtgcacatgccaacaacatgatg
gcccaggcgcctgcgcagaaccagtttttgccgcagaaccagttcccatcatccagtggg
gcaatgagtgtgaacagtgtaggcatggggcaaccagcggcccagacaggcgtgtcacag
ggacaggtgcctggtgctgctcttcctaatcccttgaacatgcttgggccccaggctagc
cagctaccttgcccaccagtgacacagtcaccattgcaccagacgccacctcctgcttcc
acagctgctggcatgccatctctccagcatccaacggcacctgggatgactcctccccag
ccagcagctcctacccagccatcaactcctgtctcgtcttccgggcagactcccacccca
actcctggctcagtgcccagtgctagtcaagcccagagcacccctacggtccaggcagca
gcccaggtgaccccgcagcctcagaccccagtccagcccccatccgtggctacccctcag
tcatctcagcagcagccaactcctgtgcatacccagcctcctggcacaccgctttcccag
gcagcagctagcattgataacagggtccccactccatcctcggtggccagtgctgaaacc
agctcccagcaaccaggacctgatgtaccaatgctggaaatgaaggctgaggtcaagact
gaggacattgagccagatgctagtgaacccaaggcagagcctgggtctgcgatgatagag
gaggatctacaaggatcttctcaagttaaagaagaatcagatacaacagagcagaaatca
gaaccaatggaagtggatgaaaagaagccagaagtaaaagtagaagctaaagaggaagag
gagaatgtcactaatggtgccgcctcccagtcagcatctccttcgcagccacgtaaaaaa
atctttaagccggaggagttgcgccaggctcttatgccaaccctagaagcactgtatcga
caggatccagagtccttaccttttcggcagcctgtagatccccagctcctaggaattcca
gattactttgacattgtgaagaaccccatggacctttccaccatcaagcggaagctggac
acgggccaataccaagaaccctggcagtatgtggacgatgtctggctgatgttcaacaat
gcctggctctataatcgcaagacgtcacgggtctataagttctgcagtaaactcgcagag
gtctttgagcaagaaatcgaccctgttatgcaatctcttggatattgttgtggacgcaag
tatgagttttccccacagactttgtgctgctatgggaagcagctctgtacaattcctcgc
gatgctgcctactacagctatcagaataggtatcatttctgtgagaagtgtttcacagag
atccagggggagaatgttaccctgggtgacgacccttcacaacctcagacgacaatttca
aaggatcagttcgaaaagaagaaaaatgataccttagatcctgaaccttttgttgattgc
aaggagtgtggccggaagatgcatcagatttgtgttttacactatgatatcatttggcct
tcaggctttgtgtgtgacaactgcttgaagaaaactggcagaactcgaaaagaaaacaaa
ttcagtgctaagagactacagaccacgcgattgggaaaccacttggaagaccgagtcaac
aagtttttgaggcgacaaaatcatcctgaagctggggaggtctttgtccgagtggtggcc
agttcagacaagactgtggaggtcaagcctgggatgaagtcacggtttgtggactctggg
gagatgtctgaatctttcccttatcgaaccaaagctctctttgcttttgaggaaattgat
ggagtggatgtgtgcttctttgggatgcatgtccaagagtatggctctgattgcccccct
ccaaacacaaggcgtgtgtacatatcttatctggacagtattcatttcttccggccccga
tgccttcggacagctgtttaccatgagatccttattggatatttagaatatgtgaagaaa
ttggggtatgtgacaggacacatctgggcctgtcccccaagtgaaggagatgactacatc
ttccattgccacccccctgatcaaaaaatcccgaaaccgaagcgcctgcaggagtggtac
aagaagatgctggacaaggcgtttgcagaacgaatcatccatgactacaaggacattttc
aaacaagcaactgaagacaggcttaccagtgccaaggaactgccctatttcgagggtgac
ttctggcccaatgtgttggaggagagtattaaggagctagaacaagaagaagaagagaga
aagaaggaagagagcacggcagctagtgaaaccacggagggcagccagggtgacagcaag
aatgccaagaaaaagaacaacaagaaaaccaacaagaataaaagcagcatcagccgagcc
aacaagaagaagcccagcatgcccaacgtgtccaacgacttgtctcagaagctctacgcc
accatggagaagcacaaagaggtcttctttgtgatccacctccatgcagggcctgtcatc
aatacactgccccccattgttgaccccgaccccttgctcagctgtgacctcatggatggg
cgtgatgccttcctcaccctcgccagggacaagcactgggagttctcctccctgaggcgg
tccaagtggtccacactgtgcatgctggtggagctgcacacccagggccaagaccgcttc
gtctacacttgcaatgagtgcaagcatcacgtggagacccgctggcactgcaccgtgtgt
gaggactacgacctttgcatcaactgctacaacacgaagagccacacacacaagatggtg
aagtgggggctgggcctagacgacgagggcggcagccagggtgagccacagtccaagagc
ccccaggagtcgcggcgcctgagcatccagcgctgcatccagtccctagtgcacgcctgc
cagtgccgcaacgccaactgctcgctgccgtcctgccagaagatgaagcgggttgtgcaa
cacaccaagggctgtaagcgcaagaccaacggaggctgcccggtgtgcaagcagctcatc
gccctttgctgctatcatgccaaacactgccaagaaaataaatgccctgtgcccttctgc
ctcaacatcaaacacaagctccgccagcaacagatccagcaccgcctgcagcaagcgcag
ctcatgcgccggcggatggccaccatgaacacccgcaacgtgcctcagcagagtctgcct
tcccctacctcagcaccacccgggacccccacccagcagcccagcacaccccagacacca
cagccccccactcagccccaaccctcacctgtgagcatgtcaccagccggcttccctagt
gtggcccggactcagccccccaccacggtgtccactgggaagcccaccaaccaggtgccg
gccccaccgccccctgcccagcccccacccgcagcagtggaggcggcccggcagatcgag
cgtgaggcccagcagcagcagcacctgtaccgggtgaacattaacaatggcatgccccca
gggcgcacgggcatggtgaccccggtgagccagatggcccctgtgggcctgaatgtgccc
cgacccaaccaagtcagtgggcctgtcatgcccaacttgccccctgggcagtggcagcag
gcgcccatcccccagcagcagccaatgccgggcatgcccagaccggtgatgtccatgcag
gcccagccaactgtggctgggccacggatgcccaatgtgcagccaccccggagcatctca
cccggtgccctgcaggacctgttgcggaccctgaagtctcccagctccccgcagcagcag
cagcaggtgctcaacatcctcaagtcaaaccctcagctgatggcagctttcattaaacag
cgcacagccaagtacgtggctagtcagcccggcctgcagccccagcccagcctccaggcc
cagcctggcctgcagccccagcccggtctgcaccagcagcctggcctgcagaacctgaat
gccatgcaaggtggcggtccacggcctggcgtgcctccacagcagcagccaatgggaggc
ctgaacccccagggccaggccttgaacatcatgaacccagggcacaaccctagcatggcg
agtatgaacccacagtacagagaaatgctgcggaggcagctgctgcagcagcaacagcag
cagcagcagcagcagcagcaacagcagggcagcgcgggcatggccgcgggcatggcaggg
catggccagttccagcagcctcaaggacccggaggctaccccccggccatgcagcagcag
cggatgcagcagcacctcccaatgcagggcagctccatgggccagatggcagctcagatg
ggacagcttagccagatggggcagcccgggctgggcgcagacagcacccccaacatccag
caggccctgcagcagcggattttgcagcagcagcagatgaagcagcagattgggtccccc
ggccagccgaaccccatgagcccccagcagcacatgctctcaggacagccacaggcctcg
caccttcctggccagcagatggccacgtcccttagtagccaggtgcggtctccggcccct
gtacagtctccgcggccccagtcccagcctccacattccagcccatcgccacggatacag
ccccagccttcaccacaccacgtctcaccccagactggttccccccacccaggactcgca
gtcaccatggccagctctatagatcagggacacttgggtaaccccgaacagagtgcaatg
ctcccacagctgaacacccccaacaggagtgcattgtccaatgagctgtccttggtcggc
gacaccacaggagacaccctagaaaagtttgtggagggtttgtag

DBGET integrated database retrieval system