KEGG   Rousettus aegyptiacus (Egyptian rousette): 107505691
Entry
107505691         CDS       T06036                                 

Gene name
ADRA1D
Definition
(RefSeq) LOW QUALITY PROTEIN: alpha-1D adrenergic receptor
  KO
K04137  adrenergic receptor alpha-1D
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04020  Calcium signaling pathway
ray04022  cGMP-PKG signaling pathway
ray04080  Neuroactive ligand-receptor interaction
ray04261  Adrenergic signaling in cardiomyocytes
ray04270  Vascular smooth muscle contraction
ray04970  Salivary secretion
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    107505691 (ADRA1D)
   04022 cGMP-PKG signaling pathway
    107505691 (ADRA1D)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    107505691 (ADRA1D)
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107505691 (ADRA1D)
   04270 Vascular smooth muscle contraction
    107505691 (ADRA1D)
  09154 Digestive system
   04970 Salivary secretion
    107505691 (ADRA1D)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:ray04030]
    107505691 (ADRA1D)
G protein-coupled receptors [BR:ray04030]
 Rhodopsin family
  Biogenic amine
   Adrenaline
    107505691 (ADRA1D)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx 7tm_4 7TM_GPCR_Srv
Other DBs
NCBI-GeneID: 107505691
NCBI-ProteinID: XP_015991484
LinkDB
Position
Unknown
AA seq 568 aa
MTFRDLLSVSFEGPRPDSSAAGSGAGGGGGGAGGSAASESPAVGRCGSAGGGGGGVXGAG
GGEDNRSSAAEPGAAGAGGEVNGTAAVGGLVVSAQGVGVGVFLAAFILMAVAGNLLVILS
VACNRHLQTVTNYFIVNLAVADLLLSTTVLPFSATMEVLGFWAFGRAFCDVWAAVDVLCC
TASILSLCTISVDRYVGVRHSLKYPAIMTERKAAAILALLWAVALVVSVGPLLGWKEPVP
PDERFCSITEEAGYAVFSSVCSFYLPMAVIVVMYCRVYVVARSTTRSLEAGVKRERGKAS
EVVLRIHCRGATSGADGAHGGMRSTKGHTFRSSLSVRLLKFSREKKAAKTLAIVVGVFVL
CWFPFFFVLPLGSLFPQLKPSEGVFKVIFWLGYFNSCVNPLIYPCSSREFKRAFLRLLRC
QCRRRRRRRPLWRVYGHHWRASTCGPRADCGPDAGAAPPGVPLALAAPSAPGTPEVQAPV
AGRRKPPSAFREWRLLGPFRRPTTQLRAKVSSLSHKIRAGNPQRAEAACALRSEVEAVSL
GVPQDVAEGATCQAYELSDYSNLRETDI
NT seq 1707 nt   +upstreamnt  +downstreamnt
atgacttttcgcgatctcctcagcgtcagtttcgagggaccccgcccggacagcagcgcc
gcgggctcgggcgcgggcggcggcgggggcggcgcgggcggctcggccgcctcggagagc
ccggcggtgggcaggtgcgggagcgcgggcggcggcggcggcggcgtgngtggcgcgggc
ggtggcgaggacaatcggagctccgccgcggagcctggggccgcgggcgcgggcggcgag
gtgaatggcacggcggccgtcgggggtctggtggtgagcgcgcagggcgtgggcgtgggc
gtcttcctggctgccttcatcctcatggccgtggcgggcaacctgcttgtcatcctctcc
gtggcctgcaaccgccacctgcagacagtcaccaactatttcattgtgaacctggccgtg
gccgacctgctgctgagcaccacggtgctgcccttctcggccaccatggaggttctgggc
ttctgggccttcggccgggccttctgcgacgtgtgggccgccgtggacgtgctgtgctgc
acggcctccatcctcagcctctgcaccatctcggtggaccgctacgtgggcgtgcgccac
tccctcaagtaccccgccatcatgaccgagcgcaaagcggcggccatcctggcgctgctc
tgggccgtagccctggtggtgtccgtggggccgcttctgggctggaaggagcccgtgccc
cccgatgagcgcttctgcagcatcaccgaggaggcaggctacgctgtcttctcctccgtg
tgttccttctacctgcccatggccgtcatcgtggtcatgtactgccgtgtgtacgtggta
gcgcgcagcaccacgcgcagcctcgaggcgggagttaagcgtgagcgcggcaaagcctcg
gaggtggtgctacgcatccattgtcgcggcgccacctcgggcgcagacggggcacacggg
ggtatgcgcagcaccaagggccacactttccgtagttcgctgtctgtgcgtctgctcaag
ttctcccgcgagaagaaggcagccaagacactggccatcgtcgtcggcgtctttgtgctc
tgctggttccccttcttcttcgtcctgccgctaggctccctgttcccacagctgaagccc
tctgagggcgtcttcaaggtgatcttctggctcggctacttcaacagctgcgtgaaccca
ctcatctacccgtgctccagccgcgagttcaagcgcgccttcctccgcctcctacgctgc
cagtgccggcgccgccggcgccgccgccccctctggcgcgtctatggccaccactggcgg
gcctcgacctgcggcccgcgcgcggactgcggccccgacgcgggcgccgcgcccccggga
gtccccctggccctcgccgcgccctcggccccaggcacgcccgaggtgcaggctcccgtc
gccggccgcagaaagccgcccagcgccttccgcgagtggaggctgcttgggccgttccga
agacccaccacccagctgcgtgccaaggtctccagcctgtcgcacaagatccgcgctggg
aacccgcagcgcgcagaggcggcgtgcgccctgcgctcggaggttgaggctgtgtcccta
ggcgtcccccaggacgtggccgagggcgccacctgccaagcctatgaactgtcagactac
agcaacctacgagagacggatatttaa

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107515454
Entry
107515454         CDS       T06036                                 

Gene name
ADRA1A
Definition
(RefSeq) alpha-1A adrenergic receptor isoform X1
  KO
K04135  adrenergic receptor alpha-1A
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04020  Calcium signaling pathway
ray04022  cGMP-PKG signaling pathway
ray04080  Neuroactive ligand-receptor interaction
ray04152  AMPK signaling pathway
ray04261  Adrenergic signaling in cardiomyocytes
ray04270  Vascular smooth muscle contraction
ray04970  Salivary secretion
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    107515454 (ADRA1A)
   04022 cGMP-PKG signaling pathway
    107515454 (ADRA1A)
   04152 AMPK signaling pathway
    107515454 (ADRA1A)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    107515454 (ADRA1A)
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107515454 (ADRA1A)
   04270 Vascular smooth muscle contraction
    107515454 (ADRA1A)
  09154 Digestive system
   04970 Salivary secretion
    107515454 (ADRA1A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:ray04030]
    107515454 (ADRA1A)
G protein-coupled receptors [BR:ray04030]
 Rhodopsin family
  Biogenic amine
   Adrenaline
    107515454 (ADRA1A)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srv 7TM_GPCR_Srx 7tm_4
Other DBs
NCBI-GeneID: 107515454
NCBI-ProteinID: XP_016009783
LinkDB
Position
Unknown
AA seq 466 aa
MVFFSGNISDSSNCTHPTAPVNISKAILLGVILGGLIIFGVLGNILVILSVACHRHLHSV
THYYIVNLAVADLLLTSTVLPFSAIFEILGYWAFGRVFCNIWAAVDVLCCTASIMGLCII
SIDRYIGVSYPLRYPTIVTQKRGLMALLCVWALSLVISIGPLFGWRQPAPEDETICQITE
EPGYVLFSALGSFYLPLAIILVMYCRVYVVAKRESRGLKSGLKTDKSDSEQVTLRIHRKN
AAVGGSGVPSSRNKTHFSVRLLKFSREKKAAKTLGIVVGCFVLCWLPFFLVMPIGSFFPD
FKPSETVFKIVFWLGYINSCINPIIYPCSSQEFKKAFQNVLKIQCLRRKQSSKGALGYTL
HPPSHALEGQHRDLVRIPVGSGETFYKISKTDGVCEWKFFSSLPRGSARTAVPKDRSACP
TARVRSKSFLQVCCCTGPSTPSHGENHPAPTIKVHTISLSENGEEV
NT seq 1401 nt   +upstreamnt  +downstreamnt
atggtgtttttctctggaaatatctctgacagctccaactgcacccacccaacagcaccg
gtgaacatttccaaggccattctgctgggggtgatcttggggggcctcatcattttcggg
gtactagggaacatcctagtcatcctctctgtggcctgccaccggcatctgcactcggtc
actcactactacattgtcaacctggctgtggccgaccttctgctaacctccacagtgctg
cccttctccgctatcttcgagatcctgggctactgggcctttggcagggttttctgcaat
atctgggcggcggtggacgtcttgtgctgcactgcatccatcatgggactctgcatcatc
tccatcgaccgctacatcggcgtgagctaccccctgcgctaccccaccatcgtcacccag
aagaggggtctcatggctctgctctgcgtctgggcgctctccctcgtcatttccatcggg
cctctgttcggctggaggcagccggccccggaggacgagaccatctgccagatcaccgag
gagccgggctacgtgctcttctctgcactgggctccttctacttgccgctggccatcatc
ctcgtcatgtactgccgggtctacgtggtggccaagagggagagccggggcctcaaatcc
ggcctcaagaccgacaagtcggactcggagcaagtgacgcttcgcatccatcggaaaaat
gccgcggtaggaggcagcggggtgcccagctccaggaacaagacgcacttctccgtgaga
ctcctcaagttttcccgggagaagaaagcggccaaaacactgggcatcgtggtcggctgc
ttcgtcctctgctggctgccttttttcttagtgatgcccatcgggtctttcttccctgat
ttcaagccctcagaaacagtttttaaaatagttttttggctcggatacataaacagctgc
atcaatcccattatatacccctgctccagtcaagagttcaaaaaggcctttcagaatgtc
ttgaaaattcagtgtctccgcagaaagcagtcttccaaaggtgccctgggctacaccctg
cacccgcccagccacgccctggaggggcagcacagggacctggtgcgcatccctgtgggc
tcaggagagaccttctataaaatctccaagacggatggggtctgtgaatggaagtttttc
tcttccctgccccgtggatcggccaggactgcagtgcccaaagaccgatcagcctgcccc
acagcccgggtgaggagcaaaagctttttgcaggtctgctgctgcacggggccctcgacc
cccagccatggagagaaccatccagctccaaccattaaggtccacaccatctccctcagt
gaaaacggggaggaagtctag

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107521889
Entry
107521889         CDS       T06036                                 

Gene name
ADRA1B
Definition
(RefSeq) alpha-1B adrenergic receptor
  KO
K04136  adrenergic receptor alpha-1B
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04020  Calcium signaling pathway
ray04022  cGMP-PKG signaling pathway
ray04080  Neuroactive ligand-receptor interaction
ray04261  Adrenergic signaling in cardiomyocytes
ray04270  Vascular smooth muscle contraction
ray04970  Salivary secretion
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    107521889 (ADRA1B)
   04022 cGMP-PKG signaling pathway
    107521889 (ADRA1B)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    107521889 (ADRA1B)
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107521889 (ADRA1B)
   04270 Vascular smooth muscle contraction
    107521889 (ADRA1B)
  09154 Digestive system
   04970 Salivary secretion
    107521889 (ADRA1B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:ray04030]
    107521889 (ADRA1B)
G protein-coupled receptors [BR:ray04030]
 Rhodopsin family
  Biogenic amine
   Adrenaline
    107521889 (ADRA1B)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7tm_4 7TM_GPCR_Srx 7TM_GPCR_Srv Shisa
Other DBs
NCBI-GeneID: 107521889
NCBI-ProteinID: XP_016022532
LinkDB
Position
Unknown
AA seq 515 aa
MNPDLDTGHNTSAPAHWGEFKNANFTGPNQTSSNSTPPQLDVTRAVSVGLVLGAFILFAI
VGNILVILSVACNRHLRTPTNYFIVNLAIADLLLSFTVLPFSAALEVLGYWVLGRIFCDI
WAAVDVLCCTASILSLCAISIDRYIGVRYSLQYPTLVTRRKAILALLSVWVLSTVISIGP
LLGWKEPAPNDDKECGVTEEPFYALFSSLGSFYIPLAVILVMYCRVYVVAKRTTKNLEAG
VMREMSNSKELTLRIHSKNFHEDTLSSTKAKGHNPRSSIAVKLFKFSREKKAAKTLGIVV
GMFILCWLPFFIALPLGSLFSTLKPPDAVFKVVFWLGYFNSCLNPIIYPCSSKEFKRAFV
RILGCQCRARRRRRRRRLGGCAYTYRPWTRGGSLERSQSRKDSLDDSGSCLSGSQRTLPS
ASPSPGYLGRGAPPPVELCAFPEWKAPGALLSLPEAPGRRGRLDSGPLFTFKLLAEPESP
GTDAGANNGGCEAAADVANGQPGFKTNMPLAPGPL
NT seq 1548 nt   +upstreamnt  +downstreamnt
atgaatcccgacctggacaccggccacaacacatcagcacctgcccactggggagagttc
aaaaatgccaacttcacgggccccaaccagacctcgagcaactccacaccgccccagctg
gacgtcaccagggccgtctccgtgggcctggtgctgggcgccttcatcctttttgccatc
gtgggcaacatcttagtcatcttgtccgtggcctgcaaccgtcacctgcggacgcccacc
aactacttcatcgtcaacctggccatcgccgacctgctgctgagcttcaccgtgctgccc
ttctccgccgccctggaggtgctgggctactgggtgctgggccggatcttctgtgacatc
tgggccgcggtggacgtgctgtgctgcaccgcctccatcctgagcctgtgcgccatctcc
atcgatcgctacatcggggtgcgctactccctgcagtaccccacgctggtcacccgcagg
aaggccatcttggcgctcctcagtgtctgggtcttgtccaccgtcatctccatcgggccg
ctcctcgggtggaaggagccggcgcccaacgatgacaaggaatgcggggtcaccgaagaa
cccttctacgccctcttctcctccttgggctccttttacatccccctggcagtcattctg
gtcatgtactgccgcgtctacgtcgtcgccaagaggaccaccaagaacctggaggccgga
gtcatgagggagatgtccaactccaaggagctgaccctgaggatccactccaagaacttt
cacgaggacaccctcagcagtaccaaggccaagggccacaaccccaggagttccatagct
gtcaaactttttaagttctccagggaaaagaaagcagccaagaccttgggcatagtggtc
ggcatgttcatcttgtgttggctacccttcttcatcgctctaccgcttggctccctgttc
tccaccctgaagccccccgacgccgtgttcaaggtggtgttctggctgggctacttcaac
agctgcctcaaccccatcatctacccgtgctccagcaaggagttcaagcgcgccttcgtg
cgcatcctcgggtgccagtgccgcgcccgccgccgccgccgccgccgccgcctgggcggc
tgcgcctacacctaccggccgtggacgcgcggcggctcgctggagcgctcgcagtcgcgc
aaggactcgctggacgacagcggcagctgcctgagcggcagccagcggaccctgccctcg
gcctcgccgagccccggctacctgggccgcggcgcgccgccgcccgtcgagctgtgcgcc
ttcccggagtggaaggcgcccggcgccctgctcagcctgccggaggcccccggccgccgc
ggccgcctcgactcgggcccgctcttcaccttcaagctcctggccgagcccgagagcccc
gggaccgacgcgggtgccaacaacgggggctgcgaggccgccgccgacgtggccaacggg
cagccgggcttcaaaaccaacatgcccctggcgcccgggccgttgtag

DBGET integrated database retrieval system