KEGG   Rousettus aegyptiacus (Egyptian rousette): 107505772
Entry
107505772         CDS       T06036                                 

Definition
(RefSeq) HLA class II histocompatibility antigen, DQ alpha 2 chain-like
  KO
K06752  MHC class II antigen
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04145  Phagosome
ray04514  Cell adhesion molecules
ray04612  Antigen processing and presentation
ray04640  Hematopoietic cell lineage
ray04658  Th1 and Th2 cell differentiation
ray04659  Th17 cell differentiation
ray04672  Intestinal immune network for IgA production
ray04940  Type I diabetes mellitus
ray05140  Leishmaniasis
ray05145  Toxoplasmosis
ray05150  Staphylococcus aureus infection
ray05152  Tuberculosis
ray05164  Influenza A
ray05166  Human T-cell leukemia virus 1 infection
ray05168  Herpes simplex virus 1 infection
ray05169  Epstein-Barr virus infection
ray05310  Asthma
ray05320  Autoimmune thyroid disease
ray05321  Inflammatory bowel disease
ray05322  Systemic lupus erythematosus
ray05323  Rheumatoid arthritis
ray05330  Allograft rejection
ray05332  Graft-versus-host disease
ray05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    107505772
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    107505772
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    107505772
   04612 Antigen processing and presentation
    107505772
   04658 Th1 and Th2 cell differentiation
    107505772
   04659 Th17 cell differentiation
    107505772
   04672 Intestinal immune network for IgA production
    107505772
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    107505772
   05322 Systemic lupus erythematosus
    107505772
   05323 Rheumatoid arthritis
    107505772
   05320 Autoimmune thyroid disease
    107505772
   05321 Inflammatory bowel disease
    107505772
   05330 Allograft rejection
    107505772
   05332 Graft-versus-host disease
    107505772
  09166 Cardiovascular disease
   05416 Viral myocarditis
    107505772
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    107505772
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    107505772
   05152 Tuberculosis
    107505772
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    107505772
   05164 Influenza A
    107505772
   05168 Herpes simplex virus 1 infection
    107505772
   05169 Epstein-Barr virus infection
    107505772
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    107505772
   05140 Leishmaniasis
    107505772
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ray04147]
    107505772
Exosome [BR:ray04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   107505772
  Exosomal proteins of epithelial cells
   107505772
  Exosomal proteins of breast milk
   107505772
SSDB
Motif
Pfam: MHC_II_alpha C1-set Marek_A Ig_3 C2-set_2
Other DBs
NCBI-GeneID: 107505772
NCBI-ProteinID: XP_015991576
LinkDB
Position
Unknown
AA seq 251 aa
MTIKKALILQALTLTTMMSPCGGEDIVADHVGTYGTNVYQTYGAFGQFTYEFDGDELFYV
DLEKMETVWRLPEFCNFTKFETQSALRNIVVAKRNLDILIKNSNFTPAMNEIPEVVVFPK
SSVIIDIPNTLICLVDNIFPPVINVTWFYNGRSVVEGVAETTFYPKSDHSFFKLSYLTFL
PSTDDFYDCRVEHWGLEEPLLKHWEPEIPTPMSELTETVVCALGLAMGLMGIVTGPVLII
RSLCRDGASRH
NT seq 756 nt   +upstreamnt  +downstreamnt
atgaccataaagaaagctctgattctacaggccctcaccctgaccaccatgatgagcccc
tgtggaggtgaagacattgtggccgaccacgtgggtacttatggcacaaatgtctaccaa
acatatggcgcctttggccagttcacatatgaattcgatggagatgagctcttctacgta
gacctggaaaaaatggaaactgtgtggcgactacctgaattttgcaattttaccaagttt
gaaactcaaagtgccctgagaaacattgttgtggcaaaaagaaatttggatatcttgata
aaaaattccaactttacacctgccatgaatgaaattcctgaagtggttgtgtttcccaaa
tcttctgtgatcatcgatattcccaacaccctcatctgcctagtggacaatatatttcct
cctgtgatcaacgttacctggttttataatggacgttcagttgtagaaggagttgctgag
acaaccttctaccccaagagtgaccattctttcttcaagctcagttacctcacttttctt
ccctccactgatgatttctatgactgtagggtggagcactggggcctggaagaaccgctc
ctcaaacactgggagcctgagatcccaacccctatgtcagagctgacagagactgtggtc
tgtgccttggggttggccatgggcctcatgggcattgtgacgggccccgtcctaatcatc
cgaagcctgtgcagagatggtgcctccagacactga

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107505773
Entry
107505773         CDS       T06036                                 

Definition
(RefSeq) boLa class II histocompatibility antigen, DQB*0101 beta chain-like
  KO
K06752  MHC class II antigen
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04145  Phagosome
ray04514  Cell adhesion molecules
ray04612  Antigen processing and presentation
ray04640  Hematopoietic cell lineage
ray04658  Th1 and Th2 cell differentiation
ray04659  Th17 cell differentiation
ray04672  Intestinal immune network for IgA production
ray04940  Type I diabetes mellitus
ray05140  Leishmaniasis
ray05145  Toxoplasmosis
ray05150  Staphylococcus aureus infection
ray05152  Tuberculosis
ray05164  Influenza A
ray05166  Human T-cell leukemia virus 1 infection
ray05168  Herpes simplex virus 1 infection
ray05169  Epstein-Barr virus infection
ray05310  Asthma
ray05320  Autoimmune thyroid disease
ray05321  Inflammatory bowel disease
ray05322  Systemic lupus erythematosus
ray05323  Rheumatoid arthritis
ray05330  Allograft rejection
ray05332  Graft-versus-host disease
ray05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    107505773
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    107505773
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    107505773
   04612 Antigen processing and presentation
    107505773
   04658 Th1 and Th2 cell differentiation
    107505773
   04659 Th17 cell differentiation
    107505773
   04672 Intestinal immune network for IgA production
    107505773
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    107505773
   05322 Systemic lupus erythematosus
    107505773
   05323 Rheumatoid arthritis
    107505773
   05320 Autoimmune thyroid disease
    107505773
   05321 Inflammatory bowel disease
    107505773
   05330 Allograft rejection
    107505773
   05332 Graft-versus-host disease
    107505773
  09166 Cardiovascular disease
   05416 Viral myocarditis
    107505773
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    107505773
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    107505773
   05152 Tuberculosis
    107505773
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    107505773
   05164 Influenza A
    107505773
   05168 Herpes simplex virus 1 infection
    107505773
   05169 Epstein-Barr virus infection
    107505773
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    107505773
   05140 Leishmaniasis
    107505773
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ray04147]
    107505773
Exosome [BR:ray04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   107505773
  Exosomal proteins of epithelial cells
   107505773
  Exosomal proteins of breast milk
   107505773
SSDB
Motif
Pfam: MHC_II_beta C1-set Ig_3 ig C2-set_2 MHC_I Ig_2 DUF3592 Methyltransf_29
Other DBs
NCBI-GeneID: 107505773
NCBI-ProteinID: XP_015991577
LinkDB
Position
Unknown
AA seq 261 aa
MSGMMALWIPRGPWTAAVMVMLMVLSTPVAEARDSPQDFVFQFKGLCYFTNGTERVRGVT
RYIYNLEEYVRFDSDVGEFRAVTELGRPIAESWNSQADILEQTRAAVDTVCRHNYEVEAA
FTWQRRVEPTVTVSPTKTEALNHHNLLACSVTDFYPGQIKVRWFRNNQEETAGIVSTPLI
RNGDWTFQIIVMLEMTPQQGDVYTCHVEHPSLQSPTIVEWRAQSESARSKMLSGVGGFVL
GLIFLGLGLFIRHRKQKGLLH
NT seq 786 nt   +upstreamnt  +downstreamnt
atgtctgggatgatggctctgtggatccccagaggcccatggacagcagctgtgatggtg
atgctcatggtgctgagcaccccagtggctgaggccagagactctccacaggacttcgtg
ttccagtttaagggcctgtgctacttcaccaacgggacggagcgggtgcggggtgtgacc
agatacatctacaacctggaggagtacgtgcgcttcgacagcgacgtgggggagttccgc
gcggtgaccgagctcgggcggccgatcgccgagtcctggaactcgcaggcggacatcttg
gagcagacgcgggccgcggtggacacggtgtgcagacacaactacgaggtggaagctgcc
tttacctggcagcggcgagtggagcctacagtgaccgtctccccaaccaagacagaggct
ctaaaccaccacaacctgctggcttgctcggtgacagatttctatccaggccagatcaaa
gttcggtggttccggaacaaccaggaggagacagccggcattgtgtccacccccttaatt
aggaatggagactggaccttccagatcattgtgatgctagaaatgactccccagcaagga
gatgtctacacctgccacgtggagcaccccagcctccagagccctaccatagtggagtgg
cgagcacagtctgaatctgcccggagcaagatgctgagtggcgtcggaggcttcgtgctg
gggctgatcttccttggtctgggccttttcatccgtcacaggaaacagaaggggctcctg
cactga

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107505774
Entry
107505774         CDS       T06036                                 

Definition
(RefSeq) HLA class II histocompatibility antigen, DQ alpha 2 chain-like
  KO
K06752  MHC class II antigen
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04145  Phagosome
ray04514  Cell adhesion molecules
ray04612  Antigen processing and presentation
ray04640  Hematopoietic cell lineage
ray04658  Th1 and Th2 cell differentiation
ray04659  Th17 cell differentiation
ray04672  Intestinal immune network for IgA production
ray04940  Type I diabetes mellitus
ray05140  Leishmaniasis
ray05145  Toxoplasmosis
ray05150  Staphylococcus aureus infection
ray05152  Tuberculosis
ray05164  Influenza A
ray05166  Human T-cell leukemia virus 1 infection
ray05168  Herpes simplex virus 1 infection
ray05169  Epstein-Barr virus infection
ray05310  Asthma
ray05320  Autoimmune thyroid disease
ray05321  Inflammatory bowel disease
ray05322  Systemic lupus erythematosus
ray05323  Rheumatoid arthritis
ray05330  Allograft rejection
ray05332  Graft-versus-host disease
ray05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    107505774
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    107505774
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    107505774
   04612 Antigen processing and presentation
    107505774
   04658 Th1 and Th2 cell differentiation
    107505774
   04659 Th17 cell differentiation
    107505774
   04672 Intestinal immune network for IgA production
    107505774
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    107505774
   05322 Systemic lupus erythematosus
    107505774
   05323 Rheumatoid arthritis
    107505774
   05320 Autoimmune thyroid disease
    107505774
   05321 Inflammatory bowel disease
    107505774
   05330 Allograft rejection
    107505774
   05332 Graft-versus-host disease
    107505774
  09166 Cardiovascular disease
   05416 Viral myocarditis
    107505774
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    107505774
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    107505774
   05152 Tuberculosis
    107505774
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    107505774
   05164 Influenza A
    107505774
   05168 Herpes simplex virus 1 infection
    107505774
   05169 Epstein-Barr virus infection
    107505774
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    107505774
   05140 Leishmaniasis
    107505774
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ray04147]
    107505774
Exosome [BR:ray04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   107505774
  Exosomal proteins of epithelial cells
   107505774
  Exosomal proteins of breast milk
   107505774
SSDB
Motif
Pfam: MHC_II_alpha C1-set Ig_3 Marek_A C2-set_2
Other DBs
NCBI-GeneID: 107505774
NCBI-ProteinID: XP_015991578
LinkDB
Position
Unknown
AA seq 255 aa
MTLNSAPILGALALFALMSPCGCEDIVADHIGSYGINVYQSYGPSGYYTHEFDGDEEFYV
NLEKQETVWRLPEFGEFTSFDPQGALRNIAIAKYNLDILIKHSNSTAATKKIPEVTVFPK
SPVMLSQPNTLICLVDNIFPPVINITWLNNGHSVTEGVSETSFLSKNDHSFFKISYLTFL
PSADNIYDCKVEHWGLDKPLLKHWEPDIPTPVSELTETVVCALGLAVGLVGIVMGTVFIV
QGLRSGGASRPQGPL
NT seq 768 nt   +upstreamnt  +downstreamnt
atgaccctaaacagtgctccgattctaggggccctcgccctcttcgccctgatgagcccc
tgtggatgtgaagacattgtggctgaccacattggctcctatggcataaatgtctaccag
tcttatggtccctctggctattacacccatgaatttgatggagacgaggagttctacgtg
aacctggagaagcaagagaccgtctggcggctgcctgagtttggtgaatttacaagtttt
gacccgcagggtgcactgagaaatatagctatagcgaaatacaacttggacatcctgatt
aaacactccaactctaccgctgctaccaaaaaaattcctgaggtgactgtgtttcccaag
tctcccgtgatgctgagtcagcccaacacactcatctgtcttgtggataacatcttccct
cctgtgatcaacatcacatggttgaacaatggacactcagtcacagaaggtgtttctgag
accagcttcctctccaagaatgatcattccttcttcaagattagttacctcacttttctc
ccttctgctgacaatatttatgactgcaaagtggagcactggggcctggacaagccactt
ctgaaacactgggagcctgacatcccaacacctgtgtcagagctgacagagactgtggtt
tgtgccctgggattggccgtgggcctcgtgggcatcgtgatgggcactgtctttattgtc
caaggcctgcgctcaggtggtgcctccagaccccaagggccattatga

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107506765
Entry
107506765         CDS       T06036                                 

Definition
(RefSeq) DLA class II histocompatibility antigen, DR-1 beta chain-like
  KO
K06752  MHC class II antigen
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04145  Phagosome
ray04514  Cell adhesion molecules
ray04612  Antigen processing and presentation
ray04640  Hematopoietic cell lineage
ray04658  Th1 and Th2 cell differentiation
ray04659  Th17 cell differentiation
ray04672  Intestinal immune network for IgA production
ray04940  Type I diabetes mellitus
ray05140  Leishmaniasis
ray05145  Toxoplasmosis
ray05150  Staphylococcus aureus infection
ray05152  Tuberculosis
ray05164  Influenza A
ray05166  Human T-cell leukemia virus 1 infection
ray05168  Herpes simplex virus 1 infection
ray05169  Epstein-Barr virus infection
ray05310  Asthma
ray05320  Autoimmune thyroid disease
ray05321  Inflammatory bowel disease
ray05322  Systemic lupus erythematosus
ray05323  Rheumatoid arthritis
ray05330  Allograft rejection
ray05332  Graft-versus-host disease
ray05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    107506765
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    107506765
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    107506765
   04612 Antigen processing and presentation
    107506765
   04658 Th1 and Th2 cell differentiation
    107506765
   04659 Th17 cell differentiation
    107506765
   04672 Intestinal immune network for IgA production
    107506765
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    107506765
   05322 Systemic lupus erythematosus
    107506765
   05323 Rheumatoid arthritis
    107506765
   05320 Autoimmune thyroid disease
    107506765
   05321 Inflammatory bowel disease
    107506765
   05330 Allograft rejection
    107506765
   05332 Graft-versus-host disease
    107506765
  09166 Cardiovascular disease
   05416 Viral myocarditis
    107506765
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    107506765
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    107506765
   05152 Tuberculosis
    107506765
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    107506765
   05164 Influenza A
    107506765
   05168 Herpes simplex virus 1 infection
    107506765
   05169 Epstein-Barr virus infection
    107506765
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    107506765
   05140 Leishmaniasis
    107506765
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ray04147]
    107506765
Exosome [BR:ray04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   107506765
  Exosomal proteins of epithelial cells
   107506765
  Exosomal proteins of breast milk
   107506765
SSDB
Motif
Pfam: MHC_II_beta C1-set Ig_3 ig MHC_I Ig_2
Other DBs
NCBI-GeneID: 107506765
NCBI-ProteinID: XP_015993108
LinkDB
Position
Unknown
AA seq 266 aa
MVCLWFPRGSWMAALTVILMVLSPPLAWARVTSPHFLLLMKAECHFSNGTEQVRLLVRAI
YNGEEYARFDSDVGEFRAVTELGRPDAAYWNSQEAFIEQLRAAVDTVCRHNYGVGESFTV
QRRVEPTVTVYPSKTQRLQHHNLLVCSVNGFYPGHIEVIWLRNGQQEDAGVISTGLIQNG
DWTFQTLVMLETVPQSGEVYTCQVQHPSRTSPFSVEWRAQSESAQSKMLSGVGGFVLGLL
FLGVGLFIHFRNQKGHSGLQPTGLLS
NT seq 801 nt   +upstreamnt  +downstreamnt
atggtgtgtctgtggttccccagaggctcctggatggcagctctgaccgtaatactgatg
gtgctgagccctccgttggcttgggccagggtcacctcaccacatttcttgcttctgatg
aaggccgagtgtcatttctccaacgggacggagcaggtgcggctcctggtcagagccata
tataacggggaggagtacgcgcgcttcgacagcgacgtgggggagttccgcgcggtgacg
gagctcgggcggccggacgccgcgtactggaactcgcaggaggccttcatagagcagctg
cgggccgcggtggacaccgtgtgcagacacaactacggggttggtgagagcttcacggtg
cagcggcgagttgagcctacagtgactgtgtatccttcaaagacccagcgcctgcagcac
cacaacctcctggtctgctctgtgaacggtttctatccaggccacattgaagtcatatgg
ttgcggaatggccagcaagaggatgctggggtcatctccacaggcctgattcaaaatgga
gactggaccttccagaccctagtgatgctggaaactgttcctcagagtggagaagtctac
acctgtcaagtgcagcatccaagccggacaagccctttctcagtggaatggagagcacag
tctgaatctgcacagagcaagatgctgagcggagtcggtggcttcgttctgggtctgctc
ttccttggggtggggctgttcatccacttcaggaatcagaaaggacactctggacttcag
ccaacaggactcctgagctga

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107506766
Entry
107506766         CDS       T06036                                 

Definition
(RefSeq) HLA class II histocompatibility antigen, DR alpha chain
  KO
K06752  MHC class II antigen
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04145  Phagosome
ray04514  Cell adhesion molecules
ray04612  Antigen processing and presentation
ray04640  Hematopoietic cell lineage
ray04658  Th1 and Th2 cell differentiation
ray04659  Th17 cell differentiation
ray04672  Intestinal immune network for IgA production
ray04940  Type I diabetes mellitus
ray05140  Leishmaniasis
ray05145  Toxoplasmosis
ray05150  Staphylococcus aureus infection
ray05152  Tuberculosis
ray05164  Influenza A
ray05166  Human T-cell leukemia virus 1 infection
ray05168  Herpes simplex virus 1 infection
ray05169  Epstein-Barr virus infection
ray05310  Asthma
ray05320  Autoimmune thyroid disease
ray05321  Inflammatory bowel disease
ray05322  Systemic lupus erythematosus
ray05323  Rheumatoid arthritis
ray05330  Allograft rejection
ray05332  Graft-versus-host disease
ray05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    107506766
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    107506766
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    107506766
   04612 Antigen processing and presentation
    107506766
   04658 Th1 and Th2 cell differentiation
    107506766
   04659 Th17 cell differentiation
    107506766
   04672 Intestinal immune network for IgA production
    107506766
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    107506766
   05322 Systemic lupus erythematosus
    107506766
   05323 Rheumatoid arthritis
    107506766
   05320 Autoimmune thyroid disease
    107506766
   05321 Inflammatory bowel disease
    107506766
   05330 Allograft rejection
    107506766
   05332 Graft-versus-host disease
    107506766
  09166 Cardiovascular disease
   05416 Viral myocarditis
    107506766
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    107506766
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    107506766
   05152 Tuberculosis
    107506766
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    107506766
   05164 Influenza A
    107506766
   05168 Herpes simplex virus 1 infection
    107506766
   05169 Epstein-Barr virus infection
    107506766
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    107506766
   05140 Leishmaniasis
    107506766
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ray04147]
    107506766
Exosome [BR:ray04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   107506766
  Exosomal proteins of epithelial cells
   107506766
  Exosomal proteins of breast milk
   107506766
SSDB
Motif
Pfam: MHC_II_alpha C1-set Ig_3 Marek_A Ig_2 C2-set_2
Other DBs
NCBI-GeneID: 107506766
NCBI-ProteinID: XP_015993109
LinkDB
Position
Unknown
AA seq 254 aa
MAIIGIPTFGFFITALLMKLQESWAITENHVIIQAEFYLSPDTSSEFMFDFDGDEIFHVD
MKKTETVWRLTEFGEFASFEAQGALANIAVDKANLDIMIKRSNHTPNTNVPPEVTVLPNK
PVELGEPNTLICFIDKFSPPVVNVTWLQNGKPVTTGVSETVFLPREDHLFRKFHYLPFLP
STEDVYDCKVEHWGLDEPLLKHWEFEARTPLPETKENVVCALGLVVGLVGIIVGTIFIIK
GVRKGNAVERRGPL
NT seq 765 nt   +upstreamnt  +downstreamnt
atggccataattggaatcccgacgtttggatttttcatcacagctctcctgatgaaactt
caggaatcatgggctatcacagagaatcatgtgatcatccaggctgagttctatctgagc
cctgacacatcatccgagtttatgtttgactttgatggtgatgagattttccatgtggat
atgaaaaagacggagacagtctggcggcttacagaatttggtgaatttgccagctttgaa
gctcagggtgcattggccaatatagctgtggacaaagccaacctggacatcatgataaag
cgctccaaccataccccgaataccaatgtacctccagaggtgactgtgctcccaaacaaa
cctgtggaactgggagagcccaacaccctcatctgtttcatcgacaagttctccccacca
gtggtcaatgtcacgtggctccaaaatggaaaacctgtcaccactggagtgtcggaaaca
gtcttcctgccaagagaagaccaccttttccgcaaattccactatctcccttttctgccc
tcaactgaggatgtctatgactgcaaggtggagcactggggtttggacgagcctcttctc
aagcactgggagtttgaagcacgaaccccactcccagagacaaaagagaatgtggtgtgt
gccctgggcctggttgtgggtctggtgggcatcattgttgggaccatcttcatcatcaag
ggagtgcgcaaaggcaatgctgttgaacgccgagggcctctgtga

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107507331
Entry
107507331         CDS       T06036                                 

Definition
(RefSeq) HLA class II histocompatibility antigen, DQ alpha 2 chain-like
  KO
K06752  MHC class II antigen
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04145  Phagosome
ray04514  Cell adhesion molecules
ray04612  Antigen processing and presentation
ray04640  Hematopoietic cell lineage
ray04658  Th1 and Th2 cell differentiation
ray04659  Th17 cell differentiation
ray04672  Intestinal immune network for IgA production
ray04940  Type I diabetes mellitus
ray05140  Leishmaniasis
ray05145  Toxoplasmosis
ray05150  Staphylococcus aureus infection
ray05152  Tuberculosis
ray05164  Influenza A
ray05166  Human T-cell leukemia virus 1 infection
ray05168  Herpes simplex virus 1 infection
ray05169  Epstein-Barr virus infection
ray05310  Asthma
ray05320  Autoimmune thyroid disease
ray05321  Inflammatory bowel disease
ray05322  Systemic lupus erythematosus
ray05323  Rheumatoid arthritis
ray05330  Allograft rejection
ray05332  Graft-versus-host disease
ray05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    107507331
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    107507331
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    107507331
   04612 Antigen processing and presentation
    107507331
   04658 Th1 and Th2 cell differentiation
    107507331
   04659 Th17 cell differentiation
    107507331
   04672 Intestinal immune network for IgA production
    107507331
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    107507331
   05322 Systemic lupus erythematosus
    107507331
   05323 Rheumatoid arthritis
    107507331
   05320 Autoimmune thyroid disease
    107507331
   05321 Inflammatory bowel disease
    107507331
   05330 Allograft rejection
    107507331
   05332 Graft-versus-host disease
    107507331
  09166 Cardiovascular disease
   05416 Viral myocarditis
    107507331
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    107507331
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    107507331
   05152 Tuberculosis
    107507331
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    107507331
   05164 Influenza A
    107507331
   05168 Herpes simplex virus 1 infection
    107507331
   05169 Epstein-Barr virus infection
    107507331
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    107507331
   05140 Leishmaniasis
    107507331
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ray04147]
    107507331
Exosome [BR:ray04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   107507331
  Exosomal proteins of epithelial cells
   107507331
  Exosomal proteins of breast milk
   107507331
SSDB
Motif
Pfam: MHC_II_alpha C1-set Ig_3 C2-set_2 Marek_A SKG6
Other DBs
NCBI-GeneID: 107507331
NCBI-ProteinID: XP_015993881
LinkDB
Position
Unknown
AA seq 255 aa
MILNGALILGALALTTVMSPCGGEDIIADHVGSYGIEIYQSYGPSGQYTHEFDGDELFYV
DLEKKETVWRLPEFGTLTSFDPQGGLREMATAKYNLEILIKCSNSTPATNEVPEVTVFPK
SPMTLGEPNTLICFVDNIFPPVINITWLSNGHSVTEGVLETSFISKNDHSFFKISYLTFL
PSADDVYDCKVEHWGLDKPLLKHWEPEIPIPMSELTETVVCALGLAIGLVGIVVGTIFIV
QGLRSGVASRHQGPL
NT seq 768 nt   +upstreamnt  +downstreamnt
atgatcttaaatggagctctgattctgggggccctcgccctgactaccgtgatgagcccc
tgtggaggtgaagacatcatagctgaccacgttggttcctatggcatagagatctaccag
tcttatggtccctctggccagtacacccatgaatttgatggagatgagttgttctatgtg
gacctggagaagaaggagactgtctggcggctgcctgagtttggcacgttaacaagtttt
gacccacagggtggactgagagaaatggctacagcaaaatacaacttggaaatcttaatt
aaatgctccaactctacccctgctaccaacgaggttcctgaggtgactgtgtttcccaag
tctcccatgacactgggtgagcccaacacccttatctgttttgtggacaacatatttcct
cctgtgatcaacatcacatggttgagcaatgggcattcagtcacagaaggtgttttagag
accagcttcatctccaagaatgatcattccttcttcaagatcagttacctcaccttcctc
ccttctgctgatgatgtttatgactgcaaagtggagcactggggcctggacaagccactt
ctgaaacactgggagcctgagatcccgatccctatgtcagagctgacagagactgtggtc
tgcgccctagggttggctataggcctcgtgggcatcgtggtaggcaccatcttcattgtt
caaggcctgcgttcaggtgttgcctccagacaccaaggccccttgtga

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107507332
Entry
107507332         CDS       T06036                                 

Definition
(RefSeq) SLA class II histocompatibility antigen, DQ haplotype C beta chain-like isoform X1
  KO
K06752  MHC class II antigen
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04145  Phagosome
ray04514  Cell adhesion molecules
ray04612  Antigen processing and presentation
ray04640  Hematopoietic cell lineage
ray04658  Th1 and Th2 cell differentiation
ray04659  Th17 cell differentiation
ray04672  Intestinal immune network for IgA production
ray04940  Type I diabetes mellitus
ray05140  Leishmaniasis
ray05145  Toxoplasmosis
ray05150  Staphylococcus aureus infection
ray05152  Tuberculosis
ray05164  Influenza A
ray05166  Human T-cell leukemia virus 1 infection
ray05168  Herpes simplex virus 1 infection
ray05169  Epstein-Barr virus infection
ray05310  Asthma
ray05320  Autoimmune thyroid disease
ray05321  Inflammatory bowel disease
ray05322  Systemic lupus erythematosus
ray05323  Rheumatoid arthritis
ray05330  Allograft rejection
ray05332  Graft-versus-host disease
ray05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    107507332
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    107507332
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    107507332
   04612 Antigen processing and presentation
    107507332
   04658 Th1 and Th2 cell differentiation
    107507332
   04659 Th17 cell differentiation
    107507332
   04672 Intestinal immune network for IgA production
    107507332
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    107507332
   05322 Systemic lupus erythematosus
    107507332
   05323 Rheumatoid arthritis
    107507332
   05320 Autoimmune thyroid disease
    107507332
   05321 Inflammatory bowel disease
    107507332
   05330 Allograft rejection
    107507332
   05332 Graft-versus-host disease
    107507332
  09166 Cardiovascular disease
   05416 Viral myocarditis
    107507332
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    107507332
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    107507332
   05152 Tuberculosis
    107507332
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    107507332
   05164 Influenza A
    107507332
   05168 Herpes simplex virus 1 infection
    107507332
   05169 Epstein-Barr virus infection
    107507332
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    107507332
   05140 Leishmaniasis
    107507332
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ray04147]
    107507332
Exosome [BR:ray04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   107507332
  Exosomal proteins of epithelial cells
   107507332
  Exosomal proteins of breast milk
   107507332
SSDB
Motif
Pfam: MHC_II_beta C1-set Ig_3 C2-set_2 MHC_I ig
Other DBs
NCBI-GeneID: 107507332
NCBI-ProteinID: XP_015993882
LinkDB
Position
Unknown
AA seq 283 aa
MSGMMALWIPRGPWTAAVMVMLMVLSTPVAEARDSPQDFVYQFKGQCYFTNGTERVRLVI
RQVYNREEFVRFDSDVGEFRAVTELGRPIAKSWNSQADVLEQTRAEVDTVCRHNYEAEAL
TSLKRQVEPTVTISPSRTEALNHHNLLACLVTDFYPGQIKVRWFRNDQEQTAGIVSTPLL
RNGDWTFQVLVMLEIIPQRGDVYTCHVEHPGLQSPIEVEWRAQSESAQSKMLSGIGGCML
GLIFLGLGLFIRHRSQKGLRGSSPAGIAFCSDSMGNVGTGLLR
NT seq 852 nt   +upstreamnt  +downstreamnt
atgtctgggatgatggctctgtggatccccagaggcccatggacagcagctgtgatggtg
atgctcatggtgctgagcaccccagtggctgaggccagagactctccacaggacttcgtg
taccagtttaagggccagtgctacttcaccaacgggacggagcgggtgcggctggtgatc
agacaagtctataaccgggaggagttcgtgcgcttcgacagcgacgtgggggagttccgc
gcggtgaccgagctcgggcggccgatcgccaagtcctggaactcgcaggcggacgtcttg
gagcagacgcgggccgaggtggacacggtgtgcagacacaactacgaggcggaggccctc
acgtccttgaagcggcaagtggaacccacagtgaccatctccccatccaggacagaggct
ctaaaccaccacaacctgctggcttgcttggtgacagatttctatccaggccagatcaaa
gttcggtggttccggaatgaccaggagcagacagctggcattgtgtccaccccgctttta
aggaacggagattggacctttcaggtccttgtgatgctggaaattattcctcaacgtgga
gatgtgtacacctgccacgtggagcaccccggcctccagagccctatcgaagtggagtgg
cgagcacagtctgaatctgcccagagcaagatgctgagtggcatcgggggctgcatgctg
gggctgatcttcctcgggctgggccttttcatccgtcataggagccagaagggtcttcgt
gggtcctcaccagcaggtattgctttctgctctgattcaatggggaatgtggggacaggg
ctcctgcgttga

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107511941
Entry
107511941         CDS       T06036                                 

Definition
(RefSeq) H-2 class II histocompatibility antigen, A-R alpha chain-like
  KO
K06752  MHC class II antigen
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04145  Phagosome
ray04514  Cell adhesion molecules
ray04612  Antigen processing and presentation
ray04640  Hematopoietic cell lineage
ray04658  Th1 and Th2 cell differentiation
ray04659  Th17 cell differentiation
ray04672  Intestinal immune network for IgA production
ray04940  Type I diabetes mellitus
ray05140  Leishmaniasis
ray05145  Toxoplasmosis
ray05150  Staphylococcus aureus infection
ray05152  Tuberculosis
ray05164  Influenza A
ray05166  Human T-cell leukemia virus 1 infection
ray05168  Herpes simplex virus 1 infection
ray05169  Epstein-Barr virus infection
ray05310  Asthma
ray05320  Autoimmune thyroid disease
ray05321  Inflammatory bowel disease
ray05322  Systemic lupus erythematosus
ray05323  Rheumatoid arthritis
ray05330  Allograft rejection
ray05332  Graft-versus-host disease
ray05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    107511941
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    107511941
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    107511941
   04612 Antigen processing and presentation
    107511941
   04658 Th1 and Th2 cell differentiation
    107511941
   04659 Th17 cell differentiation
    107511941
   04672 Intestinal immune network for IgA production
    107511941
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    107511941
   05322 Systemic lupus erythematosus
    107511941
   05323 Rheumatoid arthritis
    107511941
   05320 Autoimmune thyroid disease
    107511941
   05321 Inflammatory bowel disease
    107511941
   05330 Allograft rejection
    107511941
   05332 Graft-versus-host disease
    107511941
  09166 Cardiovascular disease
   05416 Viral myocarditis
    107511941
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    107511941
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    107511941
   05152 Tuberculosis
    107511941
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    107511941
   05164 Influenza A
    107511941
   05168 Herpes simplex virus 1 infection
    107511941
   05169 Epstein-Barr virus infection
    107511941
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    107511941
   05140 Leishmaniasis
    107511941
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ray04147]
    107511941
Exosome [BR:ray04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   107511941
  Exosomal proteins of epithelial cells
   107511941
  Exosomal proteins of breast milk
   107511941
SSDB
Motif
Pfam: MHC_II_alpha C1-set Marek_A Ig_3 C2-set_2
Other DBs
NCBI-GeneID: 107511941
NCBI-ProteinID: XP_016002384
LinkDB
Position
Unknown
AA seq 225 aa
SADHVGTYGTNVYQTYGAFGQFTYEFDGDELFYVDLEKMETVWRLPEFCNFTKFETQSAL
RNIVVAKRNLDILIKNSNFTPAMNEIPEVVVFPKSSVIIDIPNTLICLVDNIFPPVINVT
WFYNGRSVVEGVAETTFYPKSDHSFFKLSYLTFLPSTDDFYDCRVEHWGLEEPLLKHWEP
EIPTPMSELTETVVCALGLAMGLMGIVTGPVLIIRSLCRDGASRH
NT seq 678 nt   +upstreamnt  +downstreamnt
tcagccgaccacgtgggtacttatggcacaaatgtctaccaaacatatggcgcctttggc
cagttcacatatgaattcgatggagatgagctcttctacgtagacctggaaaaaatggaa
actgtgtggcgactacctgaattttgcaattttaccaagtttgaaactcaaagtgccctg
agaaacattgttgtggcaaaaagaaatttggatatcttgataaaaaattccaactttaca
cctgccatgaatgaaattcctgaagtggttgtgtttcccaaatcttctgtgatcatcgat
attcccaacaccctcatctgcctagtggacaatatatttcctcctgtgatcaacgttacc
tggttttataatggacgttcagttgtagaaggagttgctgagacaaccttctaccccaag
agtgaccattctttcttcaagctcagttacctcacttttcttccctccactgatgatttc
tatgactgtagggtggagcactggggcctggaagaaccgctcctcaaacactgggagcct
gagatcccaacccctatgtcagagctgacagagactgtggtctgtgccttggggttggcc
atgggcctcatgggcattgtgacgggccccgtcctaatcatccgaagcctgtgcagagat
ggtgcctccagacactga

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107511990
Entry
107511990         CDS       T06036                                 

Definition
(RefSeq) HLA class II histocompatibility antigen, DO alpha chain
  KO
K06752  MHC class II antigen
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04145  Phagosome
ray04514  Cell adhesion molecules
ray04612  Antigen processing and presentation
ray04640  Hematopoietic cell lineage
ray04658  Th1 and Th2 cell differentiation
ray04659  Th17 cell differentiation
ray04672  Intestinal immune network for IgA production
ray04940  Type I diabetes mellitus
ray05140  Leishmaniasis
ray05145  Toxoplasmosis
ray05150  Staphylococcus aureus infection
ray05152  Tuberculosis
ray05164  Influenza A
ray05166  Human T-cell leukemia virus 1 infection
ray05168  Herpes simplex virus 1 infection
ray05169  Epstein-Barr virus infection
ray05310  Asthma
ray05320  Autoimmune thyroid disease
ray05321  Inflammatory bowel disease
ray05322  Systemic lupus erythematosus
ray05323  Rheumatoid arthritis
ray05330  Allograft rejection
ray05332  Graft-versus-host disease
ray05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    107511990
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    107511990
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    107511990
   04612 Antigen processing and presentation
    107511990
   04658 Th1 and Th2 cell differentiation
    107511990
   04659 Th17 cell differentiation
    107511990
   04672 Intestinal immune network for IgA production
    107511990
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    107511990
   05322 Systemic lupus erythematosus
    107511990
   05323 Rheumatoid arthritis
    107511990
   05320 Autoimmune thyroid disease
    107511990
   05321 Inflammatory bowel disease
    107511990
   05330 Allograft rejection
    107511990
   05332 Graft-versus-host disease
    107511990
  09166 Cardiovascular disease
   05416 Viral myocarditis
    107511990
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    107511990
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    107511990
   05152 Tuberculosis
    107511990
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    107511990
   05164 Influenza A
    107511990
   05168 Herpes simplex virus 1 infection
    107511990
   05169 Epstein-Barr virus infection
    107511990
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    107511990
   05140 Leishmaniasis
    107511990
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ray04147]
    107511990
Exosome [BR:ray04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   107511990
  Exosomal proteins of epithelial cells
   107511990
  Exosomal proteins of breast milk
   107511990
SSDB
Motif
Pfam: MHC_II_alpha C1-set Ig_3 C2-set_2 Ig_2 ig
Other DBs
NCBI-GeneID: 107511990
NCBI-ProteinID: XP_016002517
LinkDB
Position
Unknown
AA seq 249 aa
MVLSEGLVLGLHTLMAFLSPQEAGAIKADHMGSYGPAFYQSYDASGQFTHEFDGEQLFSV
ELKKREAVWRLPEFGDLTRFDPQNGLASIAMIKAHLDILVERSNHTRATNVPPRVTVLPK
SRVKLGQPNVLICIVDNIFPPVINITWLRNGQTITEGVAQSSFYSRPDHLFRKFHYLTFV
PSADDFYDCQVEHWGLDEPLLRHWEPQVPTLPDTTDTLVCALGLATGLMGFLVGIVLIIT
STCLHGIPR
NT seq 750 nt   +upstreamnt  +downstreamnt
atggtcctcagtgaggggctggtcctgggactccacaccctgatggcgttcctgagcccg
caggaagctggggccatcaaggctgaccacatgggctcctatggaccagccttctaccag
tcctatgatgcctcgggtcagttcacgcatgagtttgatggggaacagctgttctccgtg
gagctgaagaagagggaggccgtgtggcgtctgcctgagtttggcgacttgacccgcttt
gacccacagaatgggctggccagcattgcgatgatcaaagcccatctggacatcttggtg
gaacgctccaaccacaccagagccactaacgtgcctccaagggtgactgtactacccaag
tctcgagtgaagctgggccaacccaatgtcctcatctgcatcgtggacaacatcttcccc
cctgtgatcaatatcacctggctacgcaatggtcaaacaatcaccgagggggtggctcag
tccagcttctattcccggcctgatcatttgttccgcaagttccactacctgaccttcgtg
ccctcagcagacgacttctacgactgccaggtggagcactggggcctggacgagccgctc
ctcaggcactgggagccgcaggtgcctacgctgccagacactacagacaccctggtctgt
gccctgggcctggccactggactgatgggcttccttgtgggcatcgtcctcatcatcaca
agcacatgcctgcacggcatccccaggtaa

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107511992
Entry
107511992         CDS       T06036                                 

Definition
(RefSeq) HLA class II histocompatibility antigen, DM beta chain
  KO
K06752  MHC class II antigen
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04145  Phagosome
ray04514  Cell adhesion molecules
ray04612  Antigen processing and presentation
ray04640  Hematopoietic cell lineage
ray04658  Th1 and Th2 cell differentiation
ray04659  Th17 cell differentiation
ray04672  Intestinal immune network for IgA production
ray04940  Type I diabetes mellitus
ray05140  Leishmaniasis
ray05145  Toxoplasmosis
ray05150  Staphylococcus aureus infection
ray05152  Tuberculosis
ray05164  Influenza A
ray05166  Human T-cell leukemia virus 1 infection
ray05168  Herpes simplex virus 1 infection
ray05169  Epstein-Barr virus infection
ray05310  Asthma
ray05320  Autoimmune thyroid disease
ray05321  Inflammatory bowel disease
ray05322  Systemic lupus erythematosus
ray05323  Rheumatoid arthritis
ray05330  Allograft rejection
ray05332  Graft-versus-host disease
ray05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    107511992
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    107511992
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    107511992
   04612 Antigen processing and presentation
    107511992
   04658 Th1 and Th2 cell differentiation
    107511992
   04659 Th17 cell differentiation
    107511992
   04672 Intestinal immune network for IgA production
    107511992
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    107511992
   05322 Systemic lupus erythematosus
    107511992
   05323 Rheumatoid arthritis
    107511992
   05320 Autoimmune thyroid disease
    107511992
   05321 Inflammatory bowel disease
    107511992
   05330 Allograft rejection
    107511992
   05332 Graft-versus-host disease
    107511992
  09166 Cardiovascular disease
   05416 Viral myocarditis
    107511992
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    107511992
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    107511992
   05152 Tuberculosis
    107511992
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    107511992
   05164 Influenza A
    107511992
   05168 Herpes simplex virus 1 infection
    107511992
   05169 Epstein-Barr virus infection
    107511992
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    107511992
   05140 Leishmaniasis
    107511992
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ray04147]
    107511992
Exosome [BR:ray04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   107511992
  Exosomal proteins of epithelial cells
   107511992
  Exosomal proteins of breast milk
   107511992
SSDB
Motif
Pfam: MHC_II_beta C1-set Ig_3 Ig_2 ig C2-set_2 I-set
Other DBs
NCBI-GeneID: 107511992
NCBI-ProteinID: XP_016002524
LinkDB
Position
Unknown
AA seq 263 aa
MTILLQLLLGLGLGCTGADGFVAHVESTCVLDDDGTPQDFTYCISFNKDLLTCWDPEERV
MAPCEFGALNGLATYLSNYLNQQKNLLQRLTEGLQDCATHTEPFWGSLTHRTRPPSVQVA
KTTPFNTREPVMLACYVWGFYPMDVTITWKKNGQLVLPHGSAHKTSQPNGDWTYQTISYL
ATTPSFGDVYTCVVEHIGAPEPILQDWTPGLSPVQTVKVSVSAVTLGLGLIIFSLGLLSW
RRAGSSGYTSLPGSNYPEGRHIS
NT seq 792 nt   +upstreamnt  +downstreamnt
atgaccatactcctgcagctgctgctgggccttggccttggctgcaccggagcagatggc
ttcgtggcccatgtggaaagcacctgtgtgttggatgatgatgggactccacaagatttc
acatattgtatatccttcaacaaagatttgctgacctgctgggatccagaggagcgcgta
atggccccttgtgaatttggggcactaaacggcttggccacttacctctcgaattacctc
aaccagcagaaaaacctgctccagcgcttgactgaggggctccaggactgtgccacacac
acagagcccttctggggatcactgacccacaggacacggccaccatctgtgcaagtagcc
aaaaccactccttttaacacaagggagcccgtgatgctggcctgctatgtgtggggcttc
tatccaatggatgtgaccatcacgtggaagaagaacgggcagcttgtcctccctcatggc
agtgcccataagacttcccagcccaatggagactggacataccagaccatctcttattta
gccacaaccccctctttcggggatgtctacacctgtgtggtagaacatattggggctcct
gagcccatccttcaggactggacacctggactgtccccggtacagacagtgaaggtttct
gtgtctgcagtcactctgggcctgggcctcatcatcttctctcttggtttgctcagttgg
cggagagctggctcctctggttacacttccctccctgggtccaattatccagaaggtcgg
cacatttcctag

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107511993
Entry
107511993         CDS       T06036                                 

Definition
(RefSeq) HLA class II histocompatibility antigen, DM alpha chain isoform X1
  KO
K06752  MHC class II antigen
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04145  Phagosome
ray04514  Cell adhesion molecules
ray04612  Antigen processing and presentation
ray04640  Hematopoietic cell lineage
ray04658  Th1 and Th2 cell differentiation
ray04659  Th17 cell differentiation
ray04672  Intestinal immune network for IgA production
ray04940  Type I diabetes mellitus
ray05140  Leishmaniasis
ray05145  Toxoplasmosis
ray05150  Staphylococcus aureus infection
ray05152  Tuberculosis
ray05164  Influenza A
ray05166  Human T-cell leukemia virus 1 infection
ray05168  Herpes simplex virus 1 infection
ray05169  Epstein-Barr virus infection
ray05310  Asthma
ray05320  Autoimmune thyroid disease
ray05321  Inflammatory bowel disease
ray05322  Systemic lupus erythematosus
ray05323  Rheumatoid arthritis
ray05330  Allograft rejection
ray05332  Graft-versus-host disease
ray05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    107511993
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    107511993
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    107511993
   04612 Antigen processing and presentation
    107511993
   04658 Th1 and Th2 cell differentiation
    107511993
   04659 Th17 cell differentiation
    107511993
   04672 Intestinal immune network for IgA production
    107511993
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    107511993
   05322 Systemic lupus erythematosus
    107511993
   05323 Rheumatoid arthritis
    107511993
   05320 Autoimmune thyroid disease
    107511993
   05321 Inflammatory bowel disease
    107511993
   05330 Allograft rejection
    107511993
   05332 Graft-versus-host disease
    107511993
  09166 Cardiovascular disease
   05416 Viral myocarditis
    107511993
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    107511993
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    107511993
   05152 Tuberculosis
    107511993
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    107511993
   05164 Influenza A
    107511993
   05168 Herpes simplex virus 1 infection
    107511993
   05169 Epstein-Barr virus infection
    107511993
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    107511993
   05140 Leishmaniasis
    107511993
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ray04147]
    107511993
Exosome [BR:ray04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   107511993
  Exosomal proteins of epithelial cells
   107511993
  Exosomal proteins of breast milk
   107511993
SSDB
Motif
Pfam: MHC_II_alpha C1-set SKG6
Other DBs
NCBI-GeneID: 107511993
NCBI-ProteinID: XP_016002525
LinkDB
Position
Unknown
AA seq 261 aa
MDHELSWGAALLWLLHLLWLLPHSWTAPQAPTPRWQDDLQNHTFLHTMYCQNATPSVALS
ESYDGDQLFSFDFSQNIRVPRLPEFADWAQKSGDISNILFDKGFCQAMIQEIGPHLEGKI
PVSRGVPIAEVFTLKPLEFGKPNTLVCFVSNLFPPTLTVNWQHHSAPVEGVGPTYVSAVD
GLSFQAFSYLNFTPVSSDIFSCIVTHEIDGHTAIAYWVPQNALPSDLLENVLCGVAFGLG
VLGIVVGLVLIIYFRKPCSDD
NT seq 786 nt   +upstreamnt  +downstreamnt
atggatcatgaactgagctggggagctgcactgctgtggctcctacaccttctatggctg
ctgcctcactcctggaccgccccccaagctcctactccaaggtggcaggatgatctgcaa
aaccacacattcctgcacacgatgtactgtcagaacgcgactcccagtgtggcactctct
gagagctacgacggggaccagcttttctccttcgacttttcccagaacattcgagtgcct
cgcctgcctgaatttgctgactgggctcagaagtctggagatatttccaacattttgttt
gacaaaggattctgccaagccatgatccaggaaataggcccacaccttgaaggaaaaatc
ccagtgtctagaggggttcctattgctgaggtgttcacgctgaagccactggagttcggc
aagcccaacacactggtctgttttgtcagtaatctcttcccacccacattgacggtgaat
tggcagcatcattcagcccctgtggaaggagttgggcccacttatgtctcagccgttgat
ggactcagcttccaggccttttcttatttaaatttcacaccagtatcctctgacattttc
tcctgcatcgtgactcatgaaattgacggccatacagcaattgcctattgggtgccccag
aacgcgctgccctcagatcttctggagaatgtgctgtgcggcgtggcctttggcctgggt
gtgctgggcatcgtagttggcttggtcctcattatctacttccgaaagccttgctcagat
gactga

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107511999
Entry
107511999         CDS       T06036                                 

Definition
(RefSeq) HLA class II histocompatibility antigen, DO beta chain isoform X1
  KO
K06752  MHC class II antigen
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04145  Phagosome
ray04514  Cell adhesion molecules
ray04612  Antigen processing and presentation
ray04640  Hematopoietic cell lineage
ray04658  Th1 and Th2 cell differentiation
ray04659  Th17 cell differentiation
ray04672  Intestinal immune network for IgA production
ray04940  Type I diabetes mellitus
ray05140  Leishmaniasis
ray05145  Toxoplasmosis
ray05150  Staphylococcus aureus infection
ray05152  Tuberculosis
ray05164  Influenza A
ray05166  Human T-cell leukemia virus 1 infection
ray05168  Herpes simplex virus 1 infection
ray05169  Epstein-Barr virus infection
ray05310  Asthma
ray05320  Autoimmune thyroid disease
ray05321  Inflammatory bowel disease
ray05322  Systemic lupus erythematosus
ray05323  Rheumatoid arthritis
ray05330  Allograft rejection
ray05332  Graft-versus-host disease
ray05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    107511999
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    107511999
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    107511999
   04612 Antigen processing and presentation
    107511999
   04658 Th1 and Th2 cell differentiation
    107511999
   04659 Th17 cell differentiation
    107511999
   04672 Intestinal immune network for IgA production
    107511999
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    107511999
   05322 Systemic lupus erythematosus
    107511999
   05323 Rheumatoid arthritis
    107511999
   05320 Autoimmune thyroid disease
    107511999
   05321 Inflammatory bowel disease
    107511999
   05330 Allograft rejection
    107511999
   05332 Graft-versus-host disease
    107511999
  09166 Cardiovascular disease
   05416 Viral myocarditis
    107511999
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    107511999
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    107511999
   05152 Tuberculosis
    107511999
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    107511999
   05164 Influenza A
    107511999
   05168 Herpes simplex virus 1 infection
    107511999
   05169 Epstein-Barr virus infection
    107511999
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    107511999
   05140 Leishmaniasis
    107511999
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ray04147]
    107511999
Exosome [BR:ray04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   107511999
  Exosomal proteins of epithelial cells
   107511999
  Exosomal proteins of breast milk
   107511999
SSDB
Motif
Pfam: MHC_II_beta C1-set Ig_3 C2-set_2 MHC_I
Other DBs
NCBI-GeneID: 107511999
NCBI-ProteinID: XP_016002533
LinkDB
Position
Unknown
AA seq 321 aa
MGSEWVPWVVVLLVNIFRLNSSMTQGRDSPEDFVIQAKADCYFTNGTERVQFVVRFIFNL
EEYAHFDSDVGMFVALTELGQPDVELWNNRPEILERSRASVDALCRHNYKLGAPFTVERK
VQPDVTVYPERLPTLRHHNILLCSVTDFYPGDIKIRWFRNGQEERAGVMSTGLIRNGDWT
FQIMVMLEMTPELGDVYTCLVDHASLLSPVSVEWRAQSEYSWRKILSGVAAFLLGLMFLL
VGIAAHLRAQKGYAETQLSGDKVISSSLSLGSRSFSQSFDQRETLWGYEVRVALSAESLD
WEKHLPLSLQVSRSVLPPLTY
NT seq 966 nt   +upstreamnt  +downstreamnt
atgggttctgagtgggttccctgggtggtggttctgttagtgaatattttcaggctgaat
tcctctatgactcaaggcagagactctccagaagattttgtgattcaggcaaaggctgac
tgttactttaccaatgggacagaaagggtgcagtttgtggtcagattcatctttaacttg
gaggagtatgcacatttcgacagtgatgtgggaatgtttgtggccttgactgagctagga
cagcctgatgttgagttgtggaacaatcggccagagatattggagagaagtagagcttct
gtggatgcgctctgcaggcacaactacaagctgggtgcacccttcactgtggagagaaaa
gttcaaccagatgtgacagtatatccggagaggctcccaaccctgcggcaccataacatc
ctgctctgctctgtgacggatttctatccaggggacatcaagatcaggtggttccggaat
gggcaggaagagagagcaggggtcatgtccaccggccttatcaggaatggagactggacc
tttcagataatggtgatgctggaaatgactcctgaacttggagatgtctatacctgtctt
gttgatcatgccagcctgctgagccctgtatcagtggagtggagagctcagtctgaatat
tcttggagaaaaatactaagtggagtggcagccttcctgcttggactaatgttccttctg
gtggggatcgccgcccacctgagggctcagaaaggatatgcagagactcagctgtctggt
gataaggtaatatcttcttccttgtctttgggtagcagatcattctcgcagtcctttgac
cagagggagacattatggggatatgaagtaagggtggctctgtctgctgagtccctggac
tgggaaaaacatttgccattatccctgcaggtctcaagatctgttctgccaccactgaca
tactaa

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107512001
Entry
107512001         CDS       T06036                                 

Definition
(RefSeq) HLA class II histocompatibility antigen, DQ beta 1 chain-like isoform X1
  KO
K06752  MHC class II antigen
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04145  Phagosome
ray04514  Cell adhesion molecules
ray04612  Antigen processing and presentation
ray04640  Hematopoietic cell lineage
ray04658  Th1 and Th2 cell differentiation
ray04659  Th17 cell differentiation
ray04672  Intestinal immune network for IgA production
ray04940  Type I diabetes mellitus
ray05140  Leishmaniasis
ray05145  Toxoplasmosis
ray05150  Staphylococcus aureus infection
ray05152  Tuberculosis
ray05164  Influenza A
ray05166  Human T-cell leukemia virus 1 infection
ray05168  Herpes simplex virus 1 infection
ray05169  Epstein-Barr virus infection
ray05310  Asthma
ray05320  Autoimmune thyroid disease
ray05321  Inflammatory bowel disease
ray05322  Systemic lupus erythematosus
ray05323  Rheumatoid arthritis
ray05330  Allograft rejection
ray05332  Graft-versus-host disease
ray05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    107512001
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    107512001
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    107512001
   04612 Antigen processing and presentation
    107512001
   04658 Th1 and Th2 cell differentiation
    107512001
   04659 Th17 cell differentiation
    107512001
   04672 Intestinal immune network for IgA production
    107512001
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    107512001
   05322 Systemic lupus erythematosus
    107512001
   05323 Rheumatoid arthritis
    107512001
   05320 Autoimmune thyroid disease
    107512001
   05321 Inflammatory bowel disease
    107512001
   05330 Allograft rejection
    107512001
   05332 Graft-versus-host disease
    107512001
  09166 Cardiovascular disease
   05416 Viral myocarditis
    107512001
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    107512001
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    107512001
   05152 Tuberculosis
    107512001
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    107512001
   05164 Influenza A
    107512001
   05168 Herpes simplex virus 1 infection
    107512001
   05169 Epstein-Barr virus infection
    107512001
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    107512001
   05140 Leishmaniasis
    107512001
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ray04147]
    107512001
Exosome [BR:ray04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   107512001
  Exosomal proteins of epithelial cells
   107512001
  Exosomal proteins of breast milk
   107512001
SSDB
Motif
Pfam: MHC_II_beta C1-set Ig_3 ig
Other DBs
NCBI-GeneID: 107512001
NCBI-ProteinID: XP_016002537
LinkDB
Position
Unknown
AA seq 284 aa
MLLLNCFCFKCVKMTVTILRNSWTVAGIVMVIFMVLRTPMAHRRGVPKDFVYQFKGMCYF
TNGMERVRLVARQIYNKEEIVRFDSDVGMFVAVTELGRSNAQSWNSQKDLLAEYRAQVDT
LCRHNYKETAQFTVQRRVEPTVTISPARTVFLNHHNLLVCLVTNFYPRQIKVRWFRNKQE
ETTGVVSTPLIQNGDWTYQILVMLEIVPQRGDVYICHVDHSSLQHPITVEWRAQSESAQS
KMMSGIGGFVLGLISFGLGLIIHLWNMKEHPEVPLTGNIPTLLA
NT seq 855 nt   +upstreamnt  +downstreamnt
atgcttttgttaaattgtttctgttttaagtgtgtaaagatgactgtgacgatcctcagg
aactcttggactgtagctggaattgtgatggttattttcatggtgctgaggactcccatg
gctcaccgcagaggtgttccaaaggatttcgtgtaccagtttaagggcatgtgctacttc
accaacgggatggagcgtgtgcggcttgtggccagacaaatctacaacaaggaggagatc
gtgcgctttgacagcgacgtggggatgtttgtggctgtaacagagctggggcggtcgaat
gctcagagttggaacagccagaaagacctcctggcagagtatcgggcccaggtggacacg
ctgtgcagacacaattataaggagaccgctcagttcactgttcagcggagagtggagcct
acagtgaccatctctccagccaggacagtgtttctaaaccaccataacctgctggtttgc
ttggtgacaaatttctatcctcgtcaaattaaagtcagatggttccggaataaacaagaa
gagacgactggagttgtgtccacacctcttattcagaatggggactggacctaccagatt
cttgtgatgctagaaatagtaccccagcgaggagatgtctacatctgccacgtggaccac
tccagcctccagcaccccatcacggtagaatggcgggcacagtctgaatctgcccagagc
aagatgatgagtggaattgggggttttgtgctgggactgatctcttttggtttgggcctt
atcatccacctttggaatatgaaagaacaccctgaggttccacttacaggtaatattccc
actcttcttgcttag

DBGET integrated database retrieval system