KEGG   Rousettus aegyptiacus (Egyptian rousette): 107505885
Entry
107505885         CDS       T06036                                 

Gene name
KNG1
Definition
(RefSeq) kininogen-1 isoform X1
  KO
K03898  kininogen
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04022  cGMP-PKG signaling pathway
ray04071  Sphingolipid signaling pathway
ray04080  Neuroactive ligand-receptor interaction
ray04610  Complement and coagulation cascades
ray04750  Inflammatory mediator regulation of TRP channels
ray04810  Regulation of actin cytoskeleton
ray05142  Chagas disease
ray05143  African trypanosomiasis
ray05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04071 Sphingolipid signaling pathway
    107505885 (KNG1)
   04022 cGMP-PKG signaling pathway
    107505885 (KNG1)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    107505885 (KNG1)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107505885 (KNG1)
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    107505885 (KNG1)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    107505885 (KNG1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107505885 (KNG1)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    107505885 (KNG1)
   05143 African trypanosomiasis
    107505885 (KNG1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:ray01002]
    107505885 (KNG1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ray04147]
    107505885 (KNG1)
Peptidases and inhibitors [BR:ray01002]
 Peptidase inhibitors
  Family I25: cystatin family
   107505885 (KNG1)
Exosome [BR:ray04147]
 Exosomal proteins
  Exosomal proteins of hepatic cells
   107505885 (KNG1)
  Exosomal proteins of other cancer cells
   107505885 (KNG1)
SSDB
Motif
Pfam: Cystatin Cathelicidins SQAPI Spp-24
Other DBs
NCBI-GeneID: 107505885
NCBI-ProteinID: XP_015991744
LinkDB
Position
Unknown
AA seq 428 aa
MKLIAVLFLCSMLPLSVTQEYHSQEIDCNDEDVFKSADVALKTYNNENQSGNKFVLYRIT
EVTKTENPNPFYSFKYQIKEGDCPVQSNKTWQDCDYKDSEQAATGECTAIVGKRRNMKFV
VASQTCQITPAEGSVVTSQYDCLGCVHPISTASPELEPVLRYAIQHFNNNTHHSHLFALK
EVKSAQKQVVVGWNYKITYSIEKTNCSKENFLSLTPDCKSLLNGDTGECTDDAYLDTQRR
VASFSQKCDLFPAEESVPLPTRMCLGCPKELPVDSPELEAPLTHSIAKLNAENNGTFYFK
IDIVTRATVQVVAGRKFAIEFTARETTCSKESNEELTKNCETNKFGQILDCTADVYEVPW
EKKIYPTVKCRSLGKTSMLKRPPGFSPFRSVQVEKKKEGTTKRLRPCEYYKGQPRKAGAE
PTAESEVS
NT seq 1287 nt   +upstreamnt  +downstreamnt
atgaagttgattgccgtccttttcctttgctccatgctgccgctaagtgtaacccaagag
taccactcgcaagaaattgactgcaatgatgaggatgtatttaagtctgcagatgtagct
ctgaagacatataataatgaaaaccaaagtggcaacaagtttgtattgtatcgcataacc
gaagtcaccaagacggaaaaccctaacccattttattctttcaagtaccaaatcaaggag
ggtgactgtcctgttcaaagtaacaaaacctggcaagattgtgactacaaagattctgaa
caagctgccacaggagaatgcacggcaattgtggggaagagaaggaacatgaaattcgtt
gtagcttcccagacctgccagattactccagccgagggctctgtggtgacatcccagtac
gactgccttggctgcgtgcaccccatatcaactgccagccctgaactggaaccagttctg
agatatgccattcaacattttaacaacaacactcatcattcccacctctttgctcttaaa
gaagtaaaaagtgcccagaaacaggtggtggttggatggaactataaaatcacatattca
attgagaaaactaattgttccaaggagaattttctgtccttaactccagactgcaagtct
cttctcaacggtgataccggtgaatgtacagatgatgcatacctggatactcagcgaaga
gttgcttccttctcacagaaatgtgacctttttccagcggaggaatctgtaccactacct
accaggatgtgccttggctgccccaaagagctacctgttgacagtccagagctggaggca
cctctgactcattccattgcaaaacttaatgcagagaataatggaaccttctatttcaag
attgacattgtgaccagagcaacggtacaggtggtggctggaagaaaatttgctattgag
ttcacagccagggaaaccacatgttccaaggagagtaatgaagagctgaccaaaaattgt
gagaccaataaatttggacaaattctagattgtactgctgatgtttatgaggtaccttgg
gagaaaaaaatttaccctactgtcaaatgtcgatcactaggaaagacctcaatgctgaaa
aggcctccaggtttttcacctttccgatcagtacaagtggagaaaaaaaaagaaggaaca
actaagcgcctaaggccctgcgagtactacaagggccaacctcgaaaagcaggggcagag
ccaacagctgagagtgaggtctcttga

DBGET integrated database retrieval system