KEGG   Rousettus aegyptiacus (Egyptian rousette): 107506131
Entry
107506131         CDS       T06036                                 

Gene name
AXIN1
Definition
(RefSeq) axin-1 isoform X1
  KO
K02157  axin 1
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04310  Wnt signaling pathway
ray04390  Hippo signaling pathway
ray04550  Signaling pathways regulating pluripotency of stem cells
ray04934  Cushing syndrome
ray05010  Alzheimer disease
ray05022  Pathways of neurodegeneration - multiple diseases
ray05165  Human papillomavirus infection
ray05200  Pathways in cancer
ray05210  Colorectal cancer
ray05213  Endometrial cancer
ray05217  Basal cell carcinoma
ray05224  Breast cancer
ray05225  Hepatocellular carcinoma
ray05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    107506131 (AXIN1)
   04390 Hippo signaling pathway
    107506131 (AXIN1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    107506131 (AXIN1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107506131 (AXIN1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    107506131 (AXIN1)
   05225 Hepatocellular carcinoma
    107506131 (AXIN1)
   05226 Gastric cancer
    107506131 (AXIN1)
   05217 Basal cell carcinoma
    107506131 (AXIN1)
   05213 Endometrial cancer
    107506131 (AXIN1)
   05224 Breast cancer
    107506131 (AXIN1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    107506131 (AXIN1)
   05022 Pathways of neurodegeneration - multiple diseases
    107506131 (AXIN1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    107506131 (AXIN1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    107506131 (AXIN1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:ray01009]
    107506131 (AXIN1)
Protein phosphatases and associated proteins [BR:ray01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     107506131 (AXIN1)
SSDB
Motif
Pfam: DIX RGS AXIN1_TNKS_BD Axin_b-cat_bind Rootletin Sec16
Other DBs
NCBI-GeneID: 107506131
NCBI-ProteinID: XP_015992219
LinkDB
Position
Unknown
AA seq 933 aa
MGAAPGRAPPPACPPGRRSAWAAAGALRSRPGPRHRRARDRLIHFGAISTDVLGCSAHCS
LTQSLKMNIQEQGFPLDLGASFTEDAPRPPVPGEEGELVSTDPRPVNHSFCSGKGVGIKG
ETSTATPRRSDLDLGYEPEGSASPTPPYLKWAESLHSLLDDQDGINLFRTFLKQEDCADL
LDFWFACSGFRKLEPCDSNEEKRLKLAKAIYRKYILDNSGIVSRQTKPATKSFIKDCIMK
QLIDPAMFDQAQTEIQSTMEENTYPSFLKSDIYLEYTRTGSESPKLCSDQSSGSGTGKGI
PGYLPTLNEDEEWKCDQDVDEDDGRDPAPPGRLTQKLLLETAAPRASSSRRYSEGREFRY
GPWREPVNPYYVNSGYALAPATSTNDSEQQSLSSDADSLSLTDSSVDGIPPYRIRKQHRR
EMQENVQVNGRVPLPHIPRTYRMPKEIRVEPQKFAAELIHRLEAVQRTREAEEKLEERLK
RVRMEEEGEDGDVSSAPPGASHKLPSAPAWHHFPPRYSDVGCVGLRDAHEENPESILDEH
VQRVMRTPGCQSPGPGHRSPDSAHVPKMSGVLGGTALGHGKHAPKSGVKLEAAGLHIHRH
SHHHSHHGVARPKEQAESEAARRVQSSFTWGLELHSHVAKPRSHLESVGTAPNASDSLAY
SGKAGTTSKRNAKKAESGKSASTEVPGPSEDAEKNQKIMQWIIEGEKEISRHRKAGHGSS
GVKKQQAHESSRPLSIERPGTVHPWVSAQLRNSVQPSHLFIQDPTMPPNPAPNPLTQLEE
ARRRLEEEEKRASKLPSKQRYVQEVIQRGRSCIRPACTPVLSVVPAVSDMELSETETKSQ
RKVGSGSTQPCDSIVVAYYFCGEPIPYRTLVRGRAVTLGQFKELLTKKGNYRYYFKKVSD
EFDCGVVFEEVREDEAILPVFEEKIIGKVEKVD
NT seq 2802 nt   +upstreamnt  +downstreamnt
atgggggccgccccgggccgcgcccccccccccgcctgcccgcccggccggcgcagcgca
tgggcggctgcgggcgcgctccggagccgcccggggccccgccaccgccgtgcgcgggac
agattgattcactttggagctataagtactgatgtattagggtgcagcgctcattgttca
ttgacgcaaagtctcaaaatgaatattcaagagcagggtttccctttggacctcggagca
agtttcaccgaagatgcccccagacccccagtgcctggtgaggagggtgaactggtgtcc
acagaccccaggcccgtcaaccacagcttctgctctgggaaaggtgttgggattaaaggt
gagacttcaacagccactccaaggcgctcagatctggacctggggtacgagcctgagggc
agcgcttcacccaccccaccatacttgaagtgggctgagtcgttgcactccttactagat
gatcaagatgggataaacttgtttaggactttcctgaagcaggaggactgtgccgacctg
ctggacttctggtttgcctgcagcggcttcaggaaactggagccctgtgactcaaatgag
gagaagaggctaaagttggccaaagctatttaccgaaagtacatccttgataacagtggc
atcgtgtccaggcaaaccaagccagccaccaagagtttcataaaggactgcatcatgaag
cagctgatcgatcctgccatgtttgaccaggcccaaacagaaatacagtccactatggag
gagaacacctacccctccttcctcaagtccgatatttatttggagtacacgaggacaggc
tcggagagcccgaagctctgtagtgaccagagctctgggtcagggacagggaagggcata
cctggatacctgcccactttgaacgaagatgaggaatggaaatgtgaccaagacgtagat
gaagacgatggcagagaccctgctccccctggcaggctcacgcaaaagctgcttctggag
acagctgccccacgggcctcctcaagtagacggtacagcgaaggcagagaattcaggtat
gggccctggcgggagcccgtcaatccctactacgtcaactctggctatgccctcgccccg
gccactagcaccaatgacagtgagcagcagagcctgtccagtgatgccgacagcctgtcc
ctcaccgatagcagcgtggatggaatcccaccgtacaggatccgcaagcagcaccgccgg
gagatgcaggagaacgtccaggtcaacgggcgggtgcctctacctcacattcctcgtact
taccgaatgccaaaggaaatccgtgtggagccccagaagtttgccgcagagctcatccac
cgcctggaggccgtgcagcggacacgggaggctgaggagaagctggaggagcggctgaag
cgtgtgcggatggaggaagaaggcgaggacggcgatgtttcctctgccccgccaggggcc
agtcacaagctgccttcagccccggcctggcaccacttcccaccccgctattcagatgtg
ggctgtgtggggctgcgagatgcgcatgaggaaaaccctgagagtatcctggatgaacat
gtgcaacgggtcatgaggactcccggctgccagtcaccagggccaggccaccgctcccct
gacagcgcgcacgtgcccaaaatgtcaggggtgctggggggcacagccctggggcatggt
aagcatgcacccaagtcaggtgtgaagctcgaggcagccggcctgcacatccacaggcac
agccaccatcacagccaccacggtgtggccaggcccaaggagcaggccgagagcgaggct
gcccgccgggtccagagcagcttcacgtggggtctagagctgcacagccatgtggccaag
ccccgaagccacttggagagtgtgggcactgctcccaatgccagcgacagcctggcctac
agcgggaaggccggcacgacttccaaaagaaatgctaagaaagccgagtctgggaagagt
gccagcaccgaggtgccaggcccctcagaggatgcagagaagaatcagaagatcatgcag
tggatcattgagggggagaaagagatcagtaggcacagaaaagccggccacgggtcttct
ggggtgaagaaacagcaggcccatgagagctccaggcccttgtccattgagcgtcctggg
actgtacacccctgggttagcgctcagctccggaactccgtccagccctctcatctcttc
atccaagaccccacaatgccacccaacccagcccccaaccctctgacccagctggaggag
gcccgaaggcgtctggaagaggaagagaagagagccagcaagttgccctcgaagcagagg
tatgtgcaggaggtcatccagcgggggcgctcctgcatcaggccggcgtgcacgcccgtg
ctgagcgtggtgccagcggtgtccgacatggagctctccgagacagagacaaaatcacag
aggaaggtgggcagtgggagcacccagccttgcgatagcatcgttgtggcctactacttc
tgcggggagcccattccctaccggaccctggtaaggggccgtgcagtcaccctgggccag
ttcaaggagctactgaccaagaaaggcaactatagatactactttaagaaagtgagtgac
gagtttgactgtggagtggtgtttgaggaggttcgggaagacgaggccatcctgcctgtc
ttcgaggagaagatcatcggcaaggtggagaaggtggactga

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107510301
Entry
107510301         CDS       T06036                                 

Gene name
AXIN2
Definition
(RefSeq) axin-2 isoform X1
  KO
K04385  axin 2
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04310  Wnt signaling pathway
ray04390  Hippo signaling pathway
ray04550  Signaling pathways regulating pluripotency of stem cells
ray04934  Cushing syndrome
ray05010  Alzheimer disease
ray05022  Pathways of neurodegeneration - multiple diseases
ray05165  Human papillomavirus infection
ray05200  Pathways in cancer
ray05210  Colorectal cancer
ray05213  Endometrial cancer
ray05217  Basal cell carcinoma
ray05224  Breast cancer
ray05225  Hepatocellular carcinoma
ray05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    107510301 (AXIN2)
   04390 Hippo signaling pathway
    107510301 (AXIN2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    107510301 (AXIN2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107510301 (AXIN2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    107510301 (AXIN2)
   05225 Hepatocellular carcinoma
    107510301 (AXIN2)
   05226 Gastric cancer
    107510301 (AXIN2)
   05217 Basal cell carcinoma
    107510301 (AXIN2)
   05213 Endometrial cancer
    107510301 (AXIN2)
   05224 Breast cancer
    107510301 (AXIN2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    107510301 (AXIN2)
   05022 Pathways of neurodegeneration - multiple diseases
    107510301 (AXIN2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    107510301 (AXIN2)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    107510301 (AXIN2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ray03036]
    107510301 (AXIN2)
Chromosome and associated proteins [BR:ray03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    107510301 (AXIN2)
SSDB
Motif
Pfam: RGS DIX AXIN1_TNKS_BD Axin_b-cat_bind DUF4827 SdrD_B
Other DBs
NCBI-GeneID: 107510301
NCBI-ProteinID: XP_015999165
LinkDB
Position
Unknown
AA seq 835 aa
MSSAVLVVTRLPDPSSSFREDAPRPPVPGEEGETPPCQPGVGKGQVTKPMPVSSNARRNE
DGLGEPEGRASPDSPLTRWTKSLHSLLGDQDGAYLFRTFLEREKCVDTLDFWFACNGFRQ
MNLKDTKTLRVAKAIYKRYIENNSIVSKQLKPATKTYIRDGIKKQQIDSIMFDQAQTEIQ
SVMEENAYQMFLTSDIYLEYVRSGGENTAYMSNGGLGSLKVVCGYLPTLNEEEEWTCADF
KCKLSPTVVGLSSKTLRATANVRSTETVENGYRSFKRSEPVNPYHVGSGYVFAPATSAND
SEISSDALTDDSMSMTDSSVDGIPPYRVGSKKQLQREMHRSVKANGQVSLPHFPRTHRLP
KEMTPVDPAAFAAELISRLEKLQLELESRHSLEARLQQIREDEEKEGSDLAPGSRDAAPP
QHPLSLLPSGSYEEDPQTILDDHLSRVLKTPGCQSPGVGRYSPRSRSPDRHHHHQHQQQQ
QHPHPLLPPGGRLPPAAASLAGCPLLGAKGFVTKQTTKHVHHHYIHHHAVPKTQEELEAE
AAQRVRCFCPGGPEYYCYSRCKSHPRAPEPGPADQFGGSRGSTLPKRTGRGSEPGLALPT
REGAGSLQLPGEEGDRSQDVWQWMLETERQSKPKPHSAQSTKKAYPLESSRGSPAERAGR
HHLWGGRAHPFTQDPAMPPLTPPNTLAQLEEACRRLAEVSKPPKQRCCVASQQRDRNPSA
MGQTGATPFSSPSLASEDHKEPKKPAGVHALQASELVVTYFFCGEEIPYRRMLKAQSLTL
GHFKEQLSKKGNYRYYFKKASDEFACGAVFEEIWDDETVLPTYEGRILGKVERID
NT seq 2508 nt   +upstreamnt  +downstreamnt
atgagtagtgctgtgttggtggtgactcgcctgccagaccctagcagcagcttccgcgag
gatgccccccgacccccggtccctggtgaagaaggggagaccccaccatgccagcctggg
gtgggaaagggccaggtcaccaaaccgatgcctgtctcctccaacgccaggcgcaacgag
gatgggttgggggagcctgaggggcgggcatctccggattcccccctgaccagatggacc
aagtcgttgcactccttgttgggagatcaagatggtgcttatctcttccggactttcctg
gagagggagaaatgcgtggacacgttagacttctggtttgcctgcaatggattcaggcag
atgaacctgaaggataccaaaactttgcgcgtagccaaagcaatctacaaaaggtacatc
gagaacaacagcattgtctccaagcagctgaaacctgccaccaagacctacatacgagat
ggcatcaagaagcaacagattgattccatcatgtttgaccaggcgcagaccgagatccag
tcggtgatggaggaaaatgcctaccagatgtttttgacttctgatatatacctcgaatat
gtgagaagtgggggagaaaacacagcttacatgagtaacgggggcctggggagcctaaag
gtcgtgtgtggctatctccccaccttgaatgaagaggaagagtggacttgtgctgacttc
aagtgcaaactttcgcccactgtggttggcctgtccagcaaaaccctgagggcaacagcg
aatgtgaggtccacggaaactgtcgaaaatggatacaggtccttcaagaggagcgagcct
gtcaatccataccacgtagggtctggctacgtctttgcgccagccaccagtgccaatgac
agcgagatatccagtgacgcgctgaccgacgactccatgtccatgacggacagcagcgta
gatggaatccctccttatcgtgtggggagtaagaaacagctccagagagaaatgcatcgc
agcgtgaaggccaatggccaagtgtctctacctcatttcccaagaacccaccgcctgccc
aaggagatgacccctgtggaccccgccgccttcgccgccgagctgatctccaggctggag
aagctgcagctggagctggagagtcgccacagcctggaggcccggctgcagcagatccga
gaggatgaagagaaggagggctccgacctagcgccgggctcgcgggacgcggcgcccccc
cagcaccccctctccctcctgccctccggcagctacgaggaggacccgcagacgatcctg
gacgaccacctgtccagggtcctcaagacccccggctgccagtccccgggcgttggccgc
tacagcccccgctcccgctccccggaccgccaccaccaccaccagcaccagcagcagcag
cagcacccgcaccccctcctgccgccagggggcaggctgccccccgccgccgcctccctg
gccggctgccccctcctgggcgccaagggcttcgtgaccaagcagacaacgaagcacgtc
caccaccactacatccaccaccacgccgtccccaagacccaggaggagctcgaggcggag
gccgcgcagagggtgcgctgcttctgccccggcggccccgagtactactgctactcgcgg
tgcaaaagccacccccgggcgccggagcccgggcccgcggaccagttcgggggcagcaga
ggcagtaccctgcccaagcgcaccggcagaggctcggagccgggcctagccctgcccacc
agggaaggagccgggtccctgcagctgccgggggaggaaggagacaggtcgcaggacgtc
tggcagtggatgctggagactgagcggcagagcaagcccaagccccatagtgcccaaagc
acaaaaaaggcctaccccttggaatcgagccgtgggtccccagcggagcgagcagggcgg
caccacttgtgggggggccgtgcccacccgtttacccaggaccccgcgatgcctcccctg
accccgcccaacaccctggcacagttggaggaggcctgccgcaggctggctgaggtgtcg
aagcccccaaagcaacggtgctgcgtggccagtcagcagagggacaggaatccctcagcc
atgggtcagacaggagccacacccttctccagcccaagcctggcttcagaagatcacaaa
gagccaaagaaaccagcaggggtccatgcactccaggccagcgagctggtcgtcacttac
tttttctgtggagaagaaatcccgtacaggaggatgctgaaggctcagagcttgaccctg
ggccactttaaagagcagctcagcaaaaagggaaattacaggtattacttcaaaaaagcg
agcgacgagtttgcctgcggagcggtgttcgaggagatctgggacgacgagacggtgctc
cccacgtacgaaggcaggatcctggggaaggtggagcggatcgactga

DBGET integrated database retrieval system