KEGG   Rousettus aegyptiacus (Egyptian rousette): 107506137
Entry
107506137         CDS       T06036                                 

Gene name
ARHGDIG
Definition
(RefSeq) rho GDP-dissociation inhibitor 3
  KO
K12462  Rho GDP-dissociation inhibitor
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04722  Neurotrophin signaling pathway
ray04962  Vasopressin-regulated water reabsorption
Brite
KEGG Orthology (KO) [BR:ray00001]
 09150 Organismal Systems
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    107506137 (ARHGDIG)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    107506137 (ARHGDIG)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ray04147]
    107506137 (ARHGDIG)
Exosome [BR:ray04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   107506137 (ARHGDIG)
  Exosomal proteins of other body fluids (saliva and urine)
   107506137 (ARHGDIG)
  Exosomal proteins of colorectal cancer cells
   107506137 (ARHGDIG)
SSDB
Motif
Pfam: Rho_GDI
Other DBs
NCBI-GeneID: 107506137
NCBI-ProteinID: XP_015992232
LinkDB
Position
Unknown
AA seq 225 aa
MLGLDACELGAQLLELLRLALCARVLLTDKEGGQLPPEEVLDEAVPGYRAPERKSLLEIQ
QLDPDDESLVKYKRVLLGPMPLTVDPSLPNVQVTRLTLMSEQAPGPITMDLTGELAALKN
QVFVLKEGVDYKVKITFKVNKEIVSGLKCLHHTYRRGLRVDKAVYMVGSYGPSAQEYEFV
SPVEEAPRGALVRGTYVVTSFFTDDDRADHLSWEWGLHICQDWKS
NT seq 678 nt   +upstreamnt  +downstreamnt
atgctgggcctggatgcgtgtgagctgggggcgcagctgctggaactgctccggttggca
ctgtgcgcccgagtcctcctaacagacaaggagggggggcagctgccaccagaggaggtg
ctggatgaggctgtgccagggtaccgagccccagagaggaagagcctcctagagatccag
cagctggacccagatgatgagagcctggtcaagtacaagagggtgctgctagggcccatg
ccgctgaccgtggaccccagcctgcccaacgtccaggtaaccaggctgacactgatgtct
gagcaggctccagggcccataaccatggacctcacaggggagctggctgcactgaaaaac
caggtgttcgtcctgaaggagggtgttgattacaaagtgaagattaccttcaaggtcaat
aaggagattgtcagtggcctcaaatgtctgcatcacacctaccgccggggcctgcgagtg
gacaaggccgtgtacatggtgggcagttatggcccgagcgcccaggagtatgagttcgta
agtcccgtggaggaggcgccacggggtgcgctggtgaggggcacctacgtggtcacatcc
ttcttcactgatgacgacagagcagaccacctttcctgggagtggggcctccacatctgc
caagactggaagagctga

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107508618
Entry
107508618         CDS       T06036                                 

Gene name
ARHGDIB
Definition
(RefSeq) rho GDP-dissociation inhibitor 2
  KO
K12462  Rho GDP-dissociation inhibitor
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04722  Neurotrophin signaling pathway
ray04962  Vasopressin-regulated water reabsorption
Brite
KEGG Orthology (KO) [BR:ray00001]
 09150 Organismal Systems
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    107508618 (ARHGDIB)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    107508618 (ARHGDIB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ray04147]
    107508618 (ARHGDIB)
Exosome [BR:ray04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   107508618 (ARHGDIB)
  Exosomal proteins of other body fluids (saliva and urine)
   107508618 (ARHGDIB)
  Exosomal proteins of colorectal cancer cells
   107508618 (ARHGDIB)
SSDB
Motif
Pfam: Rho_GDI
Other DBs
NCBI-GeneID: 107508618
NCBI-ProteinID: XP_015996038
LinkDB
Position
Unknown
AA seq 200 aa
MTEKAPEPHLEEDDDELDGKLNYKPPPQKSLKELQEMDKDDESLTKYKKTLLGDGPVVAD
PTAPNVTVTRLTLVCESAPGPITMDLTGDLEALKKEIFVLKEGVEYRVKIHFKVNRDIVS
GLKYVQHTYRTGVKVDKATFMVGSYGPRPEEYEFLTPIEEAPKGMLARGTYHNKSFFTDD
DKHDHLTWEWNLSIKKEWTE
NT seq 603 nt   +upstreamnt  +downstreamnt
atgactgaaaaagccccagaaccacacctggaagaggatgacgatgaactggacggcaag
ctcaattataagcctccacctcagaaatccctgaaagagctgcaggagatggacaaagat
gatgaaagtctaactaagtacaagaaaacactcctgggggatggtcctgtggtagcagac
ccaacagcccccaatgtcactgtcacccgccttaccctggtttgtgagagtgccccagga
ccgatcaccatggacctcactggggatcttgaagccctcaaaaaagaaatttttgtgcta
aaagaaggtgttgaatatagagtcaaaattcacttcaaagtgaacagagatattgtgtca
ggcctaaagtatgttcagcatacctaccggactggggtgaaagtggataaagccacattt
atggttggcagctatgggcctcgaccagaggagtatgaattcttgactccaattgaggag
gctcccaagggcatgctggcccgaggcacctaccacaacaagtccttcttcaccgacgat
gacaagcatgaccacctcacctgggagtggaacctgtccattaagaaggagtggacagaa
tga

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107520279
Entry
107520279         CDS       T06036                                 

Gene name
ARHGDIA
Definition
(RefSeq) rho GDP-dissociation inhibitor 1
  KO
K12462  Rho GDP-dissociation inhibitor
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04722  Neurotrophin signaling pathway
ray04962  Vasopressin-regulated water reabsorption
Brite
KEGG Orthology (KO) [BR:ray00001]
 09150 Organismal Systems
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    107520279 (ARHGDIA)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    107520279 (ARHGDIA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ray04147]
    107520279 (ARHGDIA)
Exosome [BR:ray04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   107520279 (ARHGDIA)
  Exosomal proteins of other body fluids (saliva and urine)
   107520279 (ARHGDIA)
  Exosomal proteins of colorectal cancer cells
   107520279 (ARHGDIA)
SSDB
Motif
Pfam: Rho_GDI DUF4249
Other DBs
NCBI-GeneID: 107520279
NCBI-ProteinID: XP_016019356
LinkDB
Position
Unknown
AA seq 204 aa
MAEQEPTAEQLAQIAADNEEDEHSVGYRPPAQKSIQEIQELDKDDESLRKYKEALLGRVA
VAADPNVPNVVVTRLTLVCSTAPGPLELDLSGDLESFKKQSFVLKEGVEYRIKISFRVNR
EIVSGMKYIQHTFRKGVRIDKTDYMVGSYGPRAEEYEFLTPMEEAPKGMLARGSYNIKSR
FTDDDKTDHLSWEWNLTIKKEWKD
NT seq 615 nt   +upstreamnt  +downstreamnt
atggccgagcaggagcccactgctgagcagctggcacagattgcagcggacaacgaggag
gacgagcactcagtgggctacaggcccccggcccagaagagcatccaggagatccaggag
ctggacaaggatgatgagagtctgcgcaagtacaaggaggccctgctgggccgtgtggct
gtggccgctgaccccaacgtccccaacgttgttgtgacccgcttgaccctggtgtgcagc
accgccccgggccccctggagttagacctgtctggggacctggagagcttcaagaagcag
tcgtttgtgctgaaagagggtgtggagtatcggataaagatctctttccgggtgaaccga
gagatcgtgtctggcatgaagtacatccagcacacgttccggaaaggcgtcaggattgac
aagaccgactacatggtggggagctacgggccgcgcgctgaggagtatgagttcctgacg
cccatggaggaggcgcccaagggcatgctggctcgcggcagctacaacatcaagtcccgc
ttcacagacgacgacaaaactgatcacctgtcctgggagtggaacctcaccatcaagaag
gagtggaaggactga

DBGET integrated database retrieval system