KEGG   Rousettus aegyptiacus (Egyptian rousette): 107506202
Entry
107506202         CDS       T06036                                 

Gene name
MYC
Definition
(RefSeq) myc proto-oncogene protein
  KO
K04377  Myc proto-oncogene protein
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04010  MAPK signaling pathway
ray04012  ErbB signaling pathway
ray04110  Cell cycle
ray04151  PI3K-Akt signaling pathway
ray04218  Cellular senescence
ray04310  Wnt signaling pathway
ray04350  TGF-beta signaling pathway
ray04390  Hippo signaling pathway
ray04550  Signaling pathways regulating pluripotency of stem cells
ray04630  JAK-STAT signaling pathway
ray04919  Thyroid hormone signaling pathway
ray05132  Salmonella infection
ray05160  Hepatitis C
ray05161  Hepatitis B
ray05163  Human cytomegalovirus infection
ray05166  Human T-cell leukemia virus 1 infection
ray05167  Kaposi sarcoma-associated herpesvirus infection
ray05169  Epstein-Barr virus infection
ray05200  Pathways in cancer
ray05202  Transcriptional misregulation in cancer
ray05205  Proteoglycans in cancer
ray05206  MicroRNAs in cancer
ray05210  Colorectal cancer
ray05213  Endometrial cancer
ray05216  Thyroid cancer
ray05219  Bladder cancer
ray05220  Chronic myeloid leukemia
ray05221  Acute myeloid leukemia
ray05222  Small cell lung cancer
ray05224  Breast cancer
ray05225  Hepatocellular carcinoma
ray05226  Gastric cancer
ray05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107506202 (MYC)
   04012 ErbB signaling pathway
    107506202 (MYC)
   04310 Wnt signaling pathway
    107506202 (MYC)
   04350 TGF-beta signaling pathway
    107506202 (MYC)
   04390 Hippo signaling pathway
    107506202 (MYC)
   04630 JAK-STAT signaling pathway
    107506202 (MYC)
   04151 PI3K-Akt signaling pathway
    107506202 (MYC)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    107506202 (MYC)
   04218 Cellular senescence
    107506202 (MYC)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    107506202 (MYC)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    107506202 (MYC)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107506202 (MYC)
   05202 Transcriptional misregulation in cancer
    107506202 (MYC)
   05206 MicroRNAs in cancer
    107506202 (MYC)
   05205 Proteoglycans in cancer
    107506202 (MYC)
   05230 Central carbon metabolism in cancer
    107506202 (MYC)
  09162 Cancer: specific types
   05210 Colorectal cancer
    107506202 (MYC)
   05225 Hepatocellular carcinoma
    107506202 (MYC)
   05226 Gastric cancer
    107506202 (MYC)
   05216 Thyroid cancer
    107506202 (MYC)
   05221 Acute myeloid leukemia
    107506202 (MYC)
   05220 Chronic myeloid leukemia
    107506202 (MYC)
   05219 Bladder cancer
    107506202 (MYC)
   05213 Endometrial cancer
    107506202 (MYC)
   05224 Breast cancer
    107506202 (MYC)
   05222 Small cell lung cancer
    107506202 (MYC)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107506202 (MYC)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    107506202 (MYC)
   05161 Hepatitis B
    107506202 (MYC)
   05160 Hepatitis C
    107506202 (MYC)
   05163 Human cytomegalovirus infection
    107506202 (MYC)
   05167 Kaposi sarcoma-associated herpesvirus infection
    107506202 (MYC)
   05169 Epstein-Barr virus infection
    107506202 (MYC)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ray03000]
    107506202 (MYC)
   03019 Messenger RNA biogenesis [BR:ray03019]
    107506202 (MYC)
Transcription factors [BR:ray03000]
 Eukaryotic type
  Basic helix-loop-helix/leucine zipper (bHLH-ZIP)
   Cell cycle controlling factors, Myc
    107506202 (MYC)
Messenger RNA biogenesis [BR:ray03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Factors involved in mRNA localization
    Factors that have mRNA localization signals
     107506202 (MYC)
SSDB
Motif
Pfam: Myc_N Myc-LZ HLH
Other DBs
NCBI-GeneID: 107506202
NCBI-ProteinID: XP_015992304
LinkDB
Position
Unknown
AA seq 440 aa
MPLNVSFANRNYDLDYDSVQPYFYCDEEENFYHQQQQSELQPPAPSEDIWKKFELLPTPP
LSPSRRSGLCSPSYVAAFASFSPRDDDDGGGGSLSTADQLEMVTELLGGDMVNQSFICDP
DDETFIKNIIIQDCMWSGFSAAAKLVSEKLASYQAARKDGGSRSPARGHSACSTSSLYLQ
DLSAAASECIDPSVVFPYPLNDSSSPKPCASPDSTAFSPSSDSLLSSAASSPRASPEPLV
LHEETPPTTSSDSEEEQEDEEEIDVVSVEKRQPPAKRSESGSPSAGSHSKPPHSPLVLKR
CHVSTHQHNYAAPPSTRKDYPPTKRAKLDSGRVLKQISNNRRCASPRSSDTEENDKRRTH
NVLERQRRNELKRSFFALRDQIPELENNEKAPKVVILKKATAYILAIQAEEQKLISEKDL
LRKRREQLKHKLEQLRNSCA
NT seq 1323 nt   +upstreamnt  +downstreamnt
atgcccctcaacgtcagcttcgccaacaggaattatgacctcgactacgactcggtgcag
ccctatttctactgcgacgaggaggagaacttctatcaccagcagcagcagagcgagctg
cagccgccggcgcccagcgaggatatctggaagaaattcgagctgctgcccaccccgccc
ctgtcgccgagccggcgctccgggctctgctctccctcctacgttgctgcattcgcgtcc
ttctcccccagggacgatgacgacggcggcggcggcagcctttccacggccgaccagctg
gagatggtgaccgagctgctgggaggagacatggtgaaccagagcttcatctgcgacccg
gacgacgagaccttcatcaaaaacatcatcatccaggactgtatgtggagtggcttctcg
gccgccgccaagctcgtctccgagaagctggcctcctaccaggctgcgcgcaaagacggc
ggcagccggagccccgcgcgcgggcacagcgcctgctccacctccagcctgtacctgcag
gacctgagcgccgccgcctccgagtgcatcgacccctctgtggtcttcccctacccgctc
aacgacagcagctcgccgaagccctgcgcctccccggactccaccgccttctccccgtcc
tcggactctctgctctcctcggccgcgtcctccccgcgggccagccccgagcccctggtg
ctccacgaggagacaccacccaccaccagcagcgactctgaggaagaacaggaggatgag
gaagaaatcgatgtcgtttctgtggaaaagaggcagccccctgccaaaaggtcagaatcg
gggtcaccctctgctggaagtcacagcaaacctcctcacagcccactggtccttaagagg
tgccacgtgtccacccatcagcacaattacgcagcgcccccctccaccaggaaagactat
ccccccaccaagagggctaagttggacagtggccgagtcctgaaacagatcagcaacaac
cgcagatgcgccagcccccggtcctcagacacggaggagaatgacaagaggcgaacacac
aacgttctggaacgccagaggagaaacgagctgaagcgcagctttttcgccctgcgtgac
cagatccctgagttggaaaacaatgaaaaggcccccaaggtagttatccttaaaaaggcc
accgcgtacatcctggccatccaagcagaggagcaaaagctcatttcagaaaaagactta
ttgcggaagcggcgagaacagttgaaacacaaacttgaacagctacggaactcttgtgca
taa

DBGET integrated database retrieval system