KEGG   Rousettus aegyptiacus (Egyptian rousette): 107506285
Entry
107506285         CDS       T06036                                 

Gene name
TCF7L1
Definition
(RefSeq) transcription factor 7-like 1
  KO
K04490  transcription factor 7-like 1
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04310  Wnt signaling pathway
ray04390  Hippo signaling pathway
ray04520  Adherens junction
ray04916  Melanogenesis
ray04934  Cushing syndrome
ray05132  Salmonella infection
ray05165  Human papillomavirus infection
ray05167  Kaposi sarcoma-associated herpesvirus infection
ray05200  Pathways in cancer
ray05210  Colorectal cancer
ray05213  Endometrial cancer
ray05215  Prostate cancer
ray05216  Thyroid cancer
ray05217  Basal cell carcinoma
ray05221  Acute myeloid leukemia
ray05224  Breast cancer
ray05225  Hepatocellular carcinoma
ray05226  Gastric cancer
ray05412  Arrhythmogenic right ventricular cardiomyopathy
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    107506285 (TCF7L1)
   04390 Hippo signaling pathway
    107506285 (TCF7L1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    107506285 (TCF7L1)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    107506285 (TCF7L1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107506285 (TCF7L1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    107506285 (TCF7L1)
   05225 Hepatocellular carcinoma
    107506285 (TCF7L1)
   05226 Gastric cancer
    107506285 (TCF7L1)
   05216 Thyroid cancer
    107506285 (TCF7L1)
   05221 Acute myeloid leukemia
    107506285 (TCF7L1)
   05217 Basal cell carcinoma
    107506285 (TCF7L1)
   05215 Prostate cancer
    107506285 (TCF7L1)
   05213 Endometrial cancer
    107506285 (TCF7L1)
   05224 Breast cancer
    107506285 (TCF7L1)
  09166 Cardiovascular disease
   05412 Arrhythmogenic right ventricular cardiomyopathy
    107506285 (TCF7L1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    107506285 (TCF7L1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107506285 (TCF7L1)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    107506285 (TCF7L1)
   05165 Human papillomavirus infection
    107506285 (TCF7L1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ray03000]
    107506285 (TCF7L1)
Transcription factors [BR:ray03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   HMG TCF-1
    107506285 (TCF7L1)
SSDB
Motif
Pfam: CTNNB1_binding HMG_box HMG_box_2
Other DBs
NCBI-GeneID: 107506285
NCBI-ProteinID: XP_015992442
LinkDB
Position
Unknown
AA seq 586 aa
MPQLGGGGGGGGGGGSSGSGAGTAGGGDDLGANDELIPFQDEGGEEQEPSSDSVSAQRDL
DEVKSSLVNESENQSSSSDSEAERRPQPARDAFQKPRDYFAEVRRPQDGAFFKGPPYPGY
PFLMIPDLSSPYLPNGPLSPGGARTYLQMKWPLLDVPSSATVKDTRSPSPAHLSNKVPVV
QHPHHMHPLTPLITYSNDHFSPGSPPTHLSPEIDPKTGIPRPPHPSELSPYYPLSPGAVG
QIPHPLGWLVPQQGQPMYSLPPGGFRHPYPALAMNASMSSLVSSRFSPHMVAPAHPGLPT
SGIPHPAIVSPIVKQEPAPPSLSPAVSAKSPVTVKKEEEKKPHVKKPLNAFMLYMKEMRA
KVVAECTLKESAAINQILGRKWHNLSREEQAKYYELARKERQLHSQLYPTWSARDNYGKK
KKRKREKQLSQTQSQQQVQEAEGALASKSKKPCVQYLPPEKPCDSPASSHGSMLDSPATP
SAALASPAAPAATHSEQAQPLSLTTKPETRAQLALHSAAFLSAKAAATSSGQMGSQPPLL
SRPLPLGSVPTALLTSPPSFPATLHAHQALPVLQAQPLSLVTKSAH
NT seq 1761 nt   +upstreamnt  +downstreamnt
atgccccagctcggcggcggcggcggcggcggcgggggaggcggcagcagcggctcgggc
gccggaacggccggaggaggggacgacctcggggcgaacgacgagctgatccccttccag
gacgaagggggcgaggagcaggagccgagcagcgacagcgtctcggcgcagcgggacctg
gacgaggtcaagtcgtccctggtcaacgagtcggagaaccagagcagcagctcggactcg
gaggcggagaggcgcccgcagcctgctcgggacgccttccagaagccgcgggactatttc
gccgaagtgagaaggccccaggacggcgcgttctttaagggccctccgtacccagggtac
ccctttctgatgatcccggacctgagcagcccttacctccccaacggacccctgtctcct
ggaggagcgcgcacgtacctgcagatgaaatggcccctcctcgatgtcccctccagcgcc
acagtcaaggacacccggtcaccgtccccagcacacttgtctaataaagttcccgttgtt
caacacccacatcacatgcacccgttgacgcccctcatcacctacagcaatgaccacttc
tcccctggctctcctcccacacacctctccccagagattgatccaaagacaggaattccc
cggccccctcacccatctgagctgtctccgtattatccactgtctcctggagctgtcgga
caaatcccccaccccctcggctggctcgtcccacagcaaggacagcccatgtactccctt
cctcctggtggtttccggcacccctaccctgccctcgccatgaacgcctcaatgtccagc
ctggtttccagtcggttctcccctcacatggtggctccggcccatcctggtctgcccacc
tcagggattccccaccccgccatcgtgtcccccatcgtcaagcaggaaccagcacccccc
agcctgagcccagccgtgagcgcgaaatcaccagtcacagtgaaaaaggaggaagaaaag
aaaccccacgtgaagaagcctcttaatgccttcatgttatatatgaaggagatgagggca
aaggtggtggctgagtgcaccctgaaggaaagcgcagccattaaccaaatcctgggaaga
aagtggcacaacctgtcccgagaagaacaggccaagtactacgaactggcccggaaggag
cggcagcttcactcccagctctacccgacctggtcggcccgggacaactacggtaagaaa
aagaagaggaagagagagaagcagctgtcgcagacacagtcccagcagcaagtccaagag
gcagagggtgctctggcctccaaaagcaagaagccatgtgttcagtacctgccccctgag
aagccctgtgacagccctgcctcctcccatggcagcatgctggactccccggctaccccc
tctgcagccttggcctcaccggctgcccctgctgcaacccactcagagcaagcccagccc
ctgtccctcaccaccaagccagagacccgggcccagctggctctccactcggctgccttc
ctgtcagctaaggctgcagccacctcctctggccagatgggcagccagcccccactcctc
tcccggcccctcccccttgggtccgttcccacggctctgctgacttctcccccttccttc
ccagccacgcttcatgcccaccaggccctcccagtactccaggcccagcctctttccttg
gtcaccaagtctgcccactaa

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107506797
Entry
107506797         CDS       T06036                                 

Gene name
TCF7
Definition
(RefSeq) transcription factor 7 isoform X1
  KO
K02620  transcription factor 7
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04310  Wnt signaling pathway
ray04390  Hippo signaling pathway
ray04520  Adherens junction
ray04550  Signaling pathways regulating pluripotency of stem cells
ray04916  Melanogenesis
ray04934  Cushing syndrome
ray05132  Salmonella infection
ray05165  Human papillomavirus infection
ray05167  Kaposi sarcoma-associated herpesvirus infection
ray05200  Pathways in cancer
ray05210  Colorectal cancer
ray05213  Endometrial cancer
ray05215  Prostate cancer
ray05216  Thyroid cancer
ray05217  Basal cell carcinoma
ray05221  Acute myeloid leukemia
ray05224  Breast cancer
ray05225  Hepatocellular carcinoma
ray05226  Gastric cancer
ray05412  Arrhythmogenic right ventricular cardiomyopathy
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    107506797 (TCF7)
   04390 Hippo signaling pathway
    107506797 (TCF7)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    107506797 (TCF7)
   04550 Signaling pathways regulating pluripotency of stem cells
    107506797 (TCF7)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    107506797 (TCF7)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107506797 (TCF7)
  09162 Cancer: specific types
   05210 Colorectal cancer
    107506797 (TCF7)
   05225 Hepatocellular carcinoma
    107506797 (TCF7)
   05226 Gastric cancer
    107506797 (TCF7)
   05216 Thyroid cancer
    107506797 (TCF7)
   05221 Acute myeloid leukemia
    107506797 (TCF7)
   05217 Basal cell carcinoma
    107506797 (TCF7)
   05215 Prostate cancer
    107506797 (TCF7)
   05213 Endometrial cancer
    107506797 (TCF7)
   05224 Breast cancer
    107506797 (TCF7)
  09166 Cardiovascular disease
   05412 Arrhythmogenic right ventricular cardiomyopathy
    107506797 (TCF7)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    107506797 (TCF7)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107506797 (TCF7)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    107506797 (TCF7)
   05165 Human papillomavirus infection
    107506797 (TCF7)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ray03000]
    107506797 (TCF7)
Transcription factors [BR:ray03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   HMG TCF-1
    107506797 (TCF7)
SSDB
Motif
Pfam: CTNNB1_binding HMG_box HMG_box_2
Other DBs
NCBI-GeneID: 107506797
NCBI-ProteinID: XP_015993132
LinkDB
Position
Unknown
AA seq 565 aa
MPQLDSGGGGAGGGDDLGAPDELLAFQDEGEEQDDKSRDSAAGPERDLAELKSSLVNESE
GAAGGAGVPGAGAGARGEAEVGTEALGREHTSQRLFPDKLPEPLEDGLKAPECASGMYKD
TVYSAFNLLMHYPPPSGAGQHPQPQPPLNKASQPTHGVPQLSPLYEHFSSPHPTPAPADM
NQKQGVHRPLQTPDLSGFYSLTSGSMGQLPHTVSWPSPPLYPLSPSCGYRQHFPAPTAAP
GTPYPRFTHPSLMLGSGVPGHPAAIPHPAIVPPSGKQELQPYDRSLKTQAESKAEKEAKK
PTIKKPLNAFMLYMKEMRAKVIAECTLKESAAINQILGRRWHALSREEQAKYYELARKER
QLHMQLYPGWSARDNYGKKKRRSREKHQESNADPGSPKKCRARFGLNQQTDWCGPCRRKK
KCIRYLPGEGRCPSPVPSDDSALGCPGSPAPQDSPSYLLLPRLPTALLASPAEPRRASPG
LSAALSPPAPWAPTGPPQCPAEYTGTATGISETGSLACTGHLASRGPPSEKQRQSPKPHG
NRPGALLTPSHGPGSGDFRGCTTSA
NT seq 1698 nt   +upstreamnt  +downstreamnt
atgccgcagctggactcgggcgggggcggcgcgggcggcggcgacgacctcggtgcgcct
gacgagctgctggccttccaggacgagggcgaggagcaggacgacaagagccgcgacagc
gccgcgggccccgagcgcgacctggctgagcttaagtcgtctctggtcaatgagtccgag
ggcgcggcgggcggagcaggggtcccgggggccggcgccggggcccgcggcgaggccgag
gtcgggaccgaggctctcgggcgggaacatacttcgcagagactttttcccgacaaactt
ccagaacctctggaagacggcctgaaggccccggagtgcgccagcggcatgtacaaagac
accgtctactccgccttcaatctgctcatgcactacccacccccttctggagcagggcag
cacccccagccgcaacccccactgaacaaggccagtcagcccacccatggcgttccgcaa
ctctctcctctctatgaacatttcagcagcccacaccccacacccgcaccggctgacatg
aaccagaagcaaggagttcacaggcctctgcagacccctgacctctctgggttctattct
ctgacctcaggcagcatgggacagctcccccacactgtgagctggcccagccctcctctc
taccccctgtccccttcctgcggatatagacagcacttccctgcccccactgcagcccct
ggcaccccctaccccaggttcacccacccatccctgatgctaggttctggcgtacctggt
caccctgcagccatcccccacccggccattgtgcccccctcagggaagcaggagctgcag
ccctatgatcgcagcctgaagacacaggcagaatccaaggcagagaaggaggccaagaag
ccaaccatcaagaagccactcaacgcctttatgctgtacatgaaggagatgagagccaaa
gtcattgcagagtgtacactcaaggagagtgctgccatcaaccagattctgggccgcagg
tggcatgcgctgtcccgagaagagcaagccaagtattatgagctggcccgcaaggagagg
cagctgcacatgcagctgtacccaggctggtcagcgcgggacaactacgggaagaagaag
aggaggtccagggaaaagcaccaagaatccaatgcagaccctggctcgcctaagaaatgc
cgtgctcgctttggcctcaaccagcagacggattggtgtggtccgtgcaggaggaaaaag
aaatgcattcggtacttacccggagaaggccgctgccccagccccgttccttccgatgac
agtgctctaggctgccctgggtccccagccccccaggactcaccctcatacctcctgctg
cctcgccttcccacagcactgcttgctagccctgcagaacccaggcgtgcatcaccaggt
ctctcagctgctctcagccccccagctccgtgggcccccacaggccccccccagtgccct
gcagaatacacaggtacagcaacaggaatctcggagacaggcagcctagcatgcacagga
cacctggcctccaggggcccaccctctgagaagcagcgacagagccccaaaccacatgga
aaccgaccaggggccctgttaactccctctcatggtccaggctctggagatttcagaggc
tgcacaacttctgcctga

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107511497
Entry
107511497         CDS       T06036                                 

Gene name
LEF1
Definition
(RefSeq) lymphoid enhancer-binding factor 1 isoform X1
  KO
K04492  lymphoid enhancer-binding factor 1
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04310  Wnt signaling pathway
ray04390  Hippo signaling pathway
ray04520  Adherens junction
ray04916  Melanogenesis
ray04934  Cushing syndrome
ray05132  Salmonella infection
ray05167  Kaposi sarcoma-associated herpesvirus infection
ray05200  Pathways in cancer
ray05210  Colorectal cancer
ray05213  Endometrial cancer
ray05215  Prostate cancer
ray05216  Thyroid cancer
ray05217  Basal cell carcinoma
ray05221  Acute myeloid leukemia
ray05224  Breast cancer
ray05225  Hepatocellular carcinoma
ray05226  Gastric cancer
ray05412  Arrhythmogenic right ventricular cardiomyopathy
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    107511497 (LEF1)
   04390 Hippo signaling pathway
    107511497 (LEF1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    107511497 (LEF1)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    107511497 (LEF1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107511497 (LEF1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    107511497 (LEF1)
   05225 Hepatocellular carcinoma
    107511497 (LEF1)
   05226 Gastric cancer
    107511497 (LEF1)
   05216 Thyroid cancer
    107511497 (LEF1)
   05221 Acute myeloid leukemia
    107511497 (LEF1)
   05217 Basal cell carcinoma
    107511497 (LEF1)
   05215 Prostate cancer
    107511497 (LEF1)
   05213 Endometrial cancer
    107511497 (LEF1)
   05224 Breast cancer
    107511497 (LEF1)
  09166 Cardiovascular disease
   05412 Arrhythmogenic right ventricular cardiomyopathy
    107511497 (LEF1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    107511497 (LEF1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107511497 (LEF1)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    107511497 (LEF1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ray03000]
    107511497 (LEF1)
Transcription factors [BR:ray03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   HMG TCF-1
    107511497 (LEF1)
SSDB
Motif
Pfam: CTNNB1_binding HMG_box HMG_box_2
Other DBs
NCBI-GeneID: 107511497
NCBI-ProteinID: XP_016001381
LinkDB
Position
Unknown
AA seq 414 aa
MPQLSGAGGGGRGDPELCATDEMIPFKDEGDPQKEKIFAEISHPEEEGDLADIKSSLVNE
SEIIPASNGHEVARQAQTSQESYHDKAREHPDDGKHPDGGLYNKGPSYSSYSGYIMMPNM
NNDPYMSNGSLSPPIPRTSNKVPVVQPSHAVHPLTPLITYSDEHFSPGSHPSHIPSDVNS
KQGMSRHPPAPEIPTFYPLSPGGVGQITPPLGWQGQPVYPITGGFRQPYPSSLSVDTSMS
RFSHHMIPGPPGPHTTGIPHPAIVTPQVKQEHPHTDSDLMHVKPQHEQRKEQEPKRPHIK
KPLNAFMLYMKEMRANVVAECTLKESAAINQILGRRWHALSREEQAKYYELARKERQLHM
QLYPGWSARDNYGKKKKRKREKLQESTSGGKRSSFPTCKAKAAAPGPLLEMEAC
NT seq 1245 nt   +upstreamnt  +downstreamnt
atgccccagctctccggggcaggaggcggcggccgcggagacccggaactctgcgccacg
gatgagatgatccctttcaaggacgagggcgatccccagaaggagaagattttcgctgag
atcagtcaccccgaagaggaaggcgacttggccgacatcaagtcttccttggttaacgag
tccgaaatcatcccggctagcaacggacacgaggtggccagacaagcacaaacctctcag
gagtcctaccacgacaaggcccgagaacaccctgatgacggaaagcatccagatggaggc
ctctacaacaagggaccctcctactcaagttattctgggtacataatgatgccaaatatg
aataatgacccatacatgtcaaatggatctctttctccacccatcccgagaacatcaaat
aaagtgcccgtggtgcagccatcccatgctgtccatcctctcacccccctcatcacttac
agcgatgagcacttttctccaggatcacacccgtcacacatcccatcagatgtcaactcc
aaacaaggcatgtccagacaccctccagctcccgagatccccaccttttacccactgtcc
ccaggtggtgttggacagattacccctcctcttggctggcaaggtcagcctgtatatccc
atcacgggaggattcaggcaaccctacccatcctcactgtcagtcgacacttccatgtcc
aggttttcccatcacatgattcctggtcctcctggtccccacacaactggcatccctcat
ccagctattgtaacgcctcaggtcaaacaggaacacccccacactgacagtgacctgatg
cacgtgaagcctcagcatgaacagagaaaggagcaggagccaaaaagacctcacattaag
aagcctctgaatgcttttatgttatacatgaaagaaatgagagcaaatgtcgtggccgag
tgtactctgaaagaaagtgcagctatcaaccagattctaggcagaaggtggcatgccctc
tcccgtgaagagcaggctaaatattatgaattagcgcggaaggaaagacagctacatatg
cagctttatccaggctggtctgcaagagacaattatggtaagaaaaagaagaggaagaga
gagaagctacaggaatctacatcaggtggaaaacgaagctcattcccaacatgcaaagcc
aaggcagcagccccgggacctcttctggagatggaagcttgttga

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107511705
Entry
107511705         CDS       T06036                                 

Gene name
TCF7L2
Definition
(RefSeq) transcription factor 7-like 2 isoform X1
  KO
K04491  transcription factor 7-like 2
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04310  Wnt signaling pathway
ray04390  Hippo signaling pathway
ray04520  Adherens junction
ray04916  Melanogenesis
ray04934  Cushing syndrome
ray05132  Salmonella infection
ray05165  Human papillomavirus infection
ray05167  Kaposi sarcoma-associated herpesvirus infection
ray05200  Pathways in cancer
ray05210  Colorectal cancer
ray05213  Endometrial cancer
ray05215  Prostate cancer
ray05216  Thyroid cancer
ray05217  Basal cell carcinoma
ray05221  Acute myeloid leukemia
ray05224  Breast cancer
ray05225  Hepatocellular carcinoma
ray05226  Gastric cancer
ray05412  Arrhythmogenic right ventricular cardiomyopathy
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    107511705 (TCF7L2)
   04390 Hippo signaling pathway
    107511705 (TCF7L2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    107511705 (TCF7L2)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    107511705 (TCF7L2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107511705 (TCF7L2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    107511705 (TCF7L2)
   05225 Hepatocellular carcinoma
    107511705 (TCF7L2)
   05226 Gastric cancer
    107511705 (TCF7L2)
   05216 Thyroid cancer
    107511705 (TCF7L2)
   05221 Acute myeloid leukemia
    107511705 (TCF7L2)
   05217 Basal cell carcinoma
    107511705 (TCF7L2)
   05215 Prostate cancer
    107511705 (TCF7L2)
   05213 Endometrial cancer
    107511705 (TCF7L2)
   05224 Breast cancer
    107511705 (TCF7L2)
  09166 Cardiovascular disease
   05412 Arrhythmogenic right ventricular cardiomyopathy
    107511705 (TCF7L2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    107511705 (TCF7L2)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107511705 (TCF7L2)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    107511705 (TCF7L2)
   05165 Human papillomavirus infection
    107511705 (TCF7L2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ray03000]
    107511705 (TCF7L2)
Transcription factors [BR:ray03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   HMG TCF-1
    107511705 (TCF7L2)
SSDB
Motif
Pfam: CTNNB1_binding HMG_box HMG_box_2
Other DBs
NCBI-GeneID: 107511705
NCBI-ProteinID: XP_016001789
LinkDB
Position
Unknown
AA seq 674 aa
MPQLNGGGGDDLGANDELISFKDEGEQEEKSSENSSAERDLADVKSSLVNESETNQNSSS
DSEAERRPPPRSESFRDKSRESLEEAAKRQDGGLFKGPPYPGYPFIMIPDLTSPYLPNGS
LSPTARTLHFQSGSTHYSAYKTIEHQIAIQYLQMKWPLLDVQAGTLQSRQALKDARSPSP
AHIVQYPLPCCTQGHDCQHLCPPSDFTVSTQVFRDMQRSHSLQKVGEPWCLESNKVPVVQ
HPHHVHPLTPLITYSNEHFTPGNPPPHLPADVDPKTGIPRPPHPPDISPYYPLSPGTVGQ
IPHPLGWLVPQQGQPVYPITTGGFRHPYPTALTVNASMSSFLSSRFPPHMVPPHHTLHTT
GIPHPAIVTPTVKQESSQSDVGSLHSSKHQDSKKKEEKKKPHIKKPLNAFMLYMKEMRAK
VVAECTLKESAAINQILGRRWHALSREEQAKYYELARKERQLHMQLYPGWSARDNYGKKK
KRKRDKQPGETNEHSECFLNPCLSLPPITDLSAPKKCRARFGLDQQNNWCGPCRRKKKCV
RYIQGEGSCLSPPSSDGSLLDSPPPSPSLLGSPPQDAKSQTEQTQPLSLSLKPDPLAHLS
MMPPPPALLLAEAAHGKAPALCPNGALDLPPAALQPPIMPSSSIAQPSTSSLHSHSSLAG
TQPQPLSLVTKSLE
NT seq 2025 nt   +upstreamnt  +downstreamnt
atgccgcagctgaacggcggtggaggagatgacctaggcgccaacgacgaactgatttcc
ttcaaagacgagggcgagcaggaggagaagagctccgaaaactcctcggcagagagggat
ttagctgatgtcaaatcgtctctagtcaatgaatcagaaacgaatcaaaacagctcctcc
gattccgaggcggaaagacggcctccgcctcgctccgaaagtttccgagataaatcccgg
gaaagtttggaagaagcggccaagaggcaagatggagggctctttaaggggccaccgtat
cccggctaccccttcatcatgatcccggacctgacgagcccctacctccccaacggatcg
ctctcgcccaccgcccgaaccctccattttcagtccgggagcacacattactctgcgtac
aaaacgattgaacaccagattgcaattcagtacctgcagatgaaatggccactgcttgat
gtccaggcggggaccctccagagcagacaagccctcaaggatgcccgctctccgtcgcca
gcccacatcgttcagtatcccctcccttgctgcactcagggacatgactgtcagcacctc
tgccccccctcagacttcactgtcagcactcaagtcttcagggacatgcaaaggagccac
tccttacaaaaggttggggagccctggtgtttggagtcgaacaaagtgccggttgtgcag
caccctcaccatgtccaccctctcacgcctctcatcacgtacagcaatgaacacttcacg
ccgggaaacccacctccacacttaccagctgacgtagaccccaaaacaggaatcccacgg
cctccgcaccctccagacatatctccgtactacccgctgtcgcccggcaccgtgggacag
atcccccatccgctaggatggttagtaccacagcaaggtcagccggtgtacccaatcacg
acaggaggattccgtcacccctaccccacagcactcacggtcaacgcttcaatgtccagc
tttctgtcttctaggttccctccccatatggtcccaccacatcacactctacacacgacc
ggcatcccccacccggccatagtcacaccaacagtcaaacaggaatcctcccagagtgac
gtcggctcactccacagctcaaagcatcaggactctaaaaagaaagaagaaaagaagaag
ccccatataaagaaacctcttaatgcgttcatgttgtatatgaaggaaatgagagcaaag
gtcgtcgccgagtgcacgttgaaagaaagcgcagccatcaaccagatcctggggcgaagg
tggcacgcgctgtctagagaagaacaagcaaagtactacgagctggcccggaaggagcga
cagcttcacatgcagctctaccctggctggtctgcacgggataactacgggaagaagaag
aagaggaaaagggacaagcagccaggggagaccaacgaacacagcgaatgtttcctaaat
ccttgcctttcacttcctccgattacagacctgagcgctcctaagaaatgccgagcgcgc
tttggccttgatcaacagaataactggtgcggcccttgcaggagaaaaaaaaagtgcgtt
cgctacatacaaggtgaaggcagctgcctcagcccaccctcttcagatggaagcttacta
gactcgcctcctccttcccccagcctgctaggctcccctccccaagacgccaagtcacag
actgagcagacccagcctctctcgctgtccctgaagcccgaccccctggcccacctctcc
atgatgcctccgccacccgccctcctgcttgccgaggccgcccatggcaaggcccccgcc
ctctgtcccaacggggccttggacctgcctcctgccgctttgcagccgcccatcatgccc
tcctcatctattgcacagccgtcaacatcttccttacattcccacagctctctggccggg
acccagccccagccgctctccctcgtaaccaagtctttagaatag

DBGET integrated database retrieval system