KEGG   Rousettus aegyptiacus (Egyptian rousette): 107506307
Entry
107506307         CDS       T06036                                 

Gene name
FYN
Definition
(RefSeq) tyrosine-protein kinase Fyn isoform X1
  KO
K05703  tyrosine-protein kinase Fyn [EC:2.7.10.2]
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04071  Sphingolipid signaling pathway
ray04072  Phospholipase D signaling pathway
ray04360  Axon guidance
ray04380  Osteoclast differentiation
ray04510  Focal adhesion
ray04520  Adherens junction
ray04611  Platelet activation
ray04650  Natural killer cell mediated cytotoxicity
ray04660  T cell receptor signaling pathway
ray04664  Fc epsilon RI signaling pathway
ray04725  Cholinergic synapse
ray05020  Prion disease
ray05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04072 Phospholipase D signaling pathway
    107506307 (FYN)
   04071 Sphingolipid signaling pathway
    107506307 (FYN)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107506307 (FYN)
   04520 Adherens junction
    107506307 (FYN)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    107506307 (FYN)
   04650 Natural killer cell mediated cytotoxicity
    107506307 (FYN)
   04660 T cell receptor signaling pathway
    107506307 (FYN)
   04664 Fc epsilon RI signaling pathway
    107506307 (FYN)
  09156 Nervous system
   04725 Cholinergic synapse
    107506307 (FYN)
  09158 Development and regeneration
   04360 Axon guidance
    107506307 (FYN)
   04380 Osteoclast differentiation
    107506307 (FYN)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05020 Prion disease
    107506307 (FYN)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    107506307 (FYN)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ray01001]
    107506307 (FYN)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ray04131]
    107506307 (FYN)
Enzymes [BR:ray01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     107506307 (FYN)
Protein kinases [BR:ray01001]
 Non-receptor tyrosine kinases
  SRC family
   107506307 (FYN)
Membrane trafficking [BR:ray04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    107506307 (FYN)
 Endocytosis
  Lipid raft mediated endocytosis
   Flotillin-dependent endocytosis
    107506307 (FYN)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase SH2 SH3_1 SH3_9 SH3_2 SH3_10 SH3_3 zf-RING_14
Other DBs
NCBI-GeneID: 107506307
NCBI-ProteinID: XP_015992473
LinkDB
Position
Unknown
AA seq 535 aa
MGCVQCKDKEATKLTEERDGSLNQSSGYRYGTDPTPQHYPSFTTIPNYNNFHAAGGQGLT
VFGGVNSSSHTGTLRTRGGTGVTLFVALYDYEARTEDDLTFHKGEKFQILNSSEGDWWEA
RSLTTGDTGYIPSNYVAPVDSIQAEEWYFGKLGRKDAERQLLSFGNPRGTFLIRESETTK
GAYSLSIRDWDDMKGDHVKHYKIRKLDNGGYYITTRAQFETLQQLVQHYSERAAGLCCRL
VVPCHKGMPRLTDLSVKTKDVWEIPRESLQLIKRLGNGQFGEVWMGTWNGNTKVAIKTLK
PGTMSPESFLEEAQIMKKLKHDKLVQLYAVVSEEPIYIVTEYMNKGSLLDFLKDGEGRAL
KLPNLVDMASQVAAGMAYIERMNYIHRDLRSANILVGNSLICKIADFGLARLIEDNEYTA
RQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELVTKGRVPYPGMNNREVLEQVERG
YRMPCPQDCPISLHELMIHCWKKDPEERPTFEYLQGFLEDYFTATEPQYQPGENL
NT seq 1608 nt   +upstreamnt  +downstreamnt
atgggctgtgtgcaatgtaaggataaagaagcaacaaaactgacagaggagagggatggc
agcctgaaccagagctccgggtaccgctatggcacagatcccactcctcagcactacccc
agcttcaccaccatcccaaactacaacaacttccacgcggccggaggccaaggactcacc
gtctttgggggtgtgaactcttcgtctcatactgggaccttgcgaacgagaggaggaaca
ggagtgacgctgtttgtggccctttatgattatgaagcacggacggaagatgacttgact
tttcacaaaggagagaaatttcaaatattgaacagctcggaaggagattggtgggaagct
cgctccttgacaactggagacacgggttacattcccagcaactacgtggctccagttgac
tctattcaggcagaagagtggtactttggaaaacttggccgaaaagatgctgagcgacag
cttttgtccttcggaaacccaagaggtacctttctaatccgtgagagtgaaaccaccaaa
ggtgcctattcactgtctatccgtgattgggatgatatgaaaggagaccacgtcaaacat
tataaaattcgcaaactcgacaatggtggatactatattaccacccgagcccagtttgaa
acacttcagcaactcgtacaacattactcagagagagccgcaggtctctgctgccgccta
gtagttccctgtcacaaagggatgccaaggcttaccgatctgtctgtcaaaaccaaagat
gtctgggaaatccctcgcgaatccctgcagttgatcaagagactgggaaatgggcagttt
ggggaagtatggatgggcacctggaatggaaacacaaaagtagccataaagactcttaaa
ccaggcacaatgtcccctgaatcattccttgaggaagcacagatcatgaagaagttgaag
catgacaagttggtccagctctatgcggtggtgtccgaggaaccaatctacattgtcacc
gagtatatgaataaaggaagtttacttgatttcttaaaagatggagaaggaagagctctg
aaattaccaaatcttgtggacatggcatcacaggttgctgcaggaatggcttacatcgag
cgcatgaattatatccacagagacctgcgatcagcaaacattctagtggggaacagtcta
atatgcaagattgctgactttggattggccagattgattgaagataatgagtacacagcc
agacaaggtgcaaagttccccattaagtggacagcccctgaagcagccctgtatgggagg
ttcacaatcaagtctgatgtgtggtctttcggaatcttacttacagagctggtcaccaaa
ggaagagtgccgtacccaggcatgaacaaccgggaggtgctggagcaggtggagcgcggc
tacaggatgccctgtccgcaggactgccccatctctctacacgagctcatgatccattgc
tggaaaaaggacccagaagaacggcccaccttcgaatacttgcagggcttcctggaagac
tacttcacagcaacggagccccagtatcaacctggtgaaaacctgtaa

DBGET integrated database retrieval system