KEGG   Rousettus aegyptiacus (Egyptian rousette): 107506450
Entry
107506450         CDS       T06036                                 

Gene name
POLK
Definition
(RefSeq) DNA polymerase kappa
  KO
K03511  DNA polymerase kappa [EC:2.7.7.7]
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray03460  Fanconi anemia pathway
ray05169  Epstein-Barr virus infection
ray05200  Pathways in cancer
ray05202  Transcriptional misregulation in cancer
ray05210  Colorectal cancer
ray05212  Pancreatic cancer
ray05213  Endometrial cancer
ray05214  Glioma
ray05216  Thyroid cancer
ray05217  Basal cell carcinoma
ray05218  Melanoma
ray05220  Chronic myeloid leukemia
ray05222  Small cell lung cancer
ray05223  Non-small cell lung cancer
ray05224  Breast cancer
ray05225  Hepatocellular carcinoma
ray05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ray00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03460 Fanconi anemia pathway
    107506450 (POLK)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107506450 (POLK)
   05202 Transcriptional misregulation in cancer
    107506450 (POLK)
  09162 Cancer: specific types
   05210 Colorectal cancer
    107506450 (POLK)
   05212 Pancreatic cancer
    107506450 (POLK)
   05225 Hepatocellular carcinoma
    107506450 (POLK)
   05226 Gastric cancer
    107506450 (POLK)
   05214 Glioma
    107506450 (POLK)
   05216 Thyroid cancer
    107506450 (POLK)
   05220 Chronic myeloid leukemia
    107506450 (POLK)
   05217 Basal cell carcinoma
    107506450 (POLK)
   05218 Melanoma
    107506450 (POLK)
   05213 Endometrial cancer
    107506450 (POLK)
   05224 Breast cancer
    107506450 (POLK)
   05222 Small cell lung cancer
    107506450 (POLK)
   05223 Non-small cell lung cancer
    107506450 (POLK)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    107506450 (POLK)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ray03400]
    107506450 (POLK)
Enzymes [BR:ray01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     107506450 (POLK)
DNA repair and recombination proteins [BR:ray03400]
 Eukaryotic type
  TLS (translesion DNA synthesis) factors
   Y-family DNA polymerases
    107506450 (POLK)
SSDB
Motif
Pfam: IMS IMS_C IMS_HHH
Other DBs
NCBI-GeneID: 107506450
NCBI-ProteinID: XP_015992626
LinkDB
Position
Unknown
AA seq 866 aa
MDNTKEKNDNYKDDLLLRMGLNDNKAGMEGLDKEKINKIIMEATKGSRFYENELKKEKQV
NQRIENMMQQKAQITSQQLRKAQLQADRFAMELEQNRDLNNTIVHVDMDAFYAAVETRDN
PELKDKPIAVGSSSMLSTSNYHARRFGVRAAMPGFIAKRLCPQLIIIPPNFDKYRAVSRE
VKEILADYDPNFMAMSLDEAYLNITKHLQERQNWPEDKRKYFIKTEESVENDNPGKEVNK
LNEHERSISPLLFEDSPPDLQTPGNTSQGNTEEQNNPQILQNSVVFGTSAEEVVKEIRFR
IEQKTTLTASAGIAPNTMLAKVCSDKNKPNGQYQILPNRQAVMDFIKDLPIRKVSGIGKV
TEKMLKALGIITCTELYQQRALLSLLFSETSWHYFLHISLGLGSTHLARDAERKSMSVER
TFSEISKAEEQYSLCQELCSELAQDLQKERLKGRTVTIKLKNVNFEVKTRAYTVSSVVST
AKEIFAIAKELLKTEIDADFPHPLRLRLMGVRLSSFPNEEDKKHQQRSIIGFLQAGNQTL
SATGCIEKTDKDQFLKPLEMSHKKSFFDKKRLERKWSHQDTFKCETVNRQSLQTSQSFQV
LKRKMNENLETPENSDKGQIFTCPVCFKEQGSISLEAFNKHVDACLDGPLISEMFSCSHT
SSTEVNKKENVHHSFSLCEKQDFETQQKNIEITSVDCIELVETVSNSSKAESVDTLSNSH
SKKECSSLPSKSVNIKHCHQNYFCTVSLENEDVESLRMREPLQPFLSEATTDQALVCPVC
NLEQKTSDLTLFNVHVDICLNKGIIQELREDRVNPVNQTKESIKSTGNSGRVQKTVTKTK
RSGPMTKHSASKKIKSNNPRQTLDTK
NT seq 2601 nt   +upstreamnt  +downstreamnt
atggataacacaaaggagaagaatgacaattacaaagatgatcttctgcttaggatggga
cttaatgataataaagctgggatggaaggattagataaagagaaaatcaacaaaattata
atggaagccacaaaggggtccagattttatgaaaatgagctcaagaaagaaaagcaggtc
aatcaacgaattgaaaatatgatgcaacaaaaagctcaaattaccagccagcagctaagg
aaagcacaattacaggctgacagatttgcaatggaattagaacagaaccgggatctgaac
aataccatagtacatgttgacatggatgctttctatgcagctgtagaaacgagggacaat
ccagaactgaaggataaacccattgctgtaggatcatcaagtatgttgtctacttcaaat
taccatgcaaggaggtttggagttcgtgcagccatgccaggatttattgctaaaagactc
tgcccacaacttattataatacccccaaactttgacaaatatagagctgtgagtagagag
gttaaggaaatacttgctgattatgatcctaattttatggccatgagtcttgatgaagcc
tacttgaatataacaaagcacttacaggaaagacaaaattggcctgaggacaaaagaaag
tattttatcaaaacagaagagtctgtagaaaacgataacccaggaaaggaagttaataaa
ctgaatgagcatgaacgatctatctctccactgctttttgaagacagtcctcctgatttg
cagaccccaggaaatacttctcaagggaacactgaagaacaaaataatcctcaaatactc
caaaactcagttgtttttggtacatcagctgaggaagtggtaaaggaaattcgtttcaga
atcgagcaaaaaacaacactgacagccagtgcaggcattgccccaaatacaatgttagca
aaagtgtgcagtgataagaataaacctaatggacaataccagattcttcccaacagacaa
gctgtgatggactttatcaaggacttacccattagaaaggtttctggaataggaaaagtt
acagagaaaatgttaaaggcccttggaattattacttgtacagagctttaccaacagagg
gcattactttctcttcttttctctgaaacatcttggcattatttccttcatatttccctg
ggtctagggtcaacacacctggcaagggatgcagagaggaaaagcatgagtgttgaaagg
acattcagtgagataagtaaagcagaagaacaatacagcttgtgccaggaactttgcagt
gaacttgctcaagatctgcagaaggaaagacttaagggtagaactgttactattaagctg
aagaatgtgaattttgaagtaaaaactcgtgcatatacagtttcatctgttgtttctact
gcaaaagaaatatttgctattgctaaagaattgctaaaaacagaaattgatgctgatttt
ccacatcccttgagattaagactgatgggtgtgcggctatctagttttcccaatgaagaa
gacaagaaacaccaacaaaggagcattattggtttcttacaggctggaaaccaaacactg
tccgccactgggtgtatagagaaaactgacaaagatcagtttttaaaacctctagaaatg
tctcataagaagagtttctttgataaaaaacgattggaaaggaagtggagccaccaagac
acatttaagtgtgaaactgtgaatagacaaagtttacagacatcacaatcattccaagtt
ttaaagaggaagatgaatgagaatttggaaacaccagagaattcagataagggtcagata
tttacctgtcctgtttgctttaaggagcaaggaagcatcagtctggaagcctttaataag
catgtagatgcatgtcttgatggacctttgatcagtgaaatgttctcatgttcacatact
tcctctacagaagttaacaagaaagaaaatgtacatcattctttttcactctgtgagaag
caggattttgaaacccagcagaagaacatagaaattacttcagtagattgtatagagttg
gtagaaactgtaagtaattcatctaaagcagaaagtgtagacactttaagcaatagccac
agcaaaaaggaatgttctagtcttccaagcaaatcggttaatatcaagcactgtcatcag
aattatttttgtactgtttcactggaaaatgaagatgttgagtcattgagaatgcgagaa
cctctccagccttttttaagtgaagcaacaacagaccaagctctagtttgtcctgtttgt
aacctggaacaaaagacttcagatcttacccttttcaatgtgcatgtggatatttgccta
aataaaggcattatccaggaactgagagaggatagagttaatccagttaaccaaaccaaa
gaaagcatcaaaagtactggtaactcaggcagagtacagaagactgtaacaaaaacaaaa
agatcaggaccgatgacaaagcactcagcatcaaagaaaataaaatcaaacaatccaaga
caaacccttgatacaaaatga

DBGET integrated database retrieval system