KEGG   Rousettus aegyptiacus (Egyptian rousette): 107506545
Entry
107506545         CDS       T06036                                 

Gene name
CAMK4
Definition
(RefSeq) calcium/calmodulin-dependent protein kinase type IV
  KO
K05869  calcium/calmodulin-dependent protein kinase IV [EC:2.7.11.17]
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04020  Calcium signaling pathway
ray04024  cAMP signaling pathway
ray04211  Longevity regulating pathway
ray04371  Apelin signaling pathway
ray04380  Osteoclast differentiation
ray04720  Long-term potentiation
ray04722  Neurotrophin signaling pathway
ray04725  Cholinergic synapse
ray04921  Oxytocin signaling pathway
ray04925  Aldosterone synthesis and secretion
ray05031  Amphetamine addiction
ray05034  Alcoholism
ray05214  Glioma
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    107506545 (CAMK4)
   04020 Calcium signaling pathway
    107506545 (CAMK4)
   04024 cAMP signaling pathway
    107506545 (CAMK4)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    107506545 (CAMK4)
   04925 Aldosterone synthesis and secretion
    107506545 (CAMK4)
  09156 Nervous system
   04725 Cholinergic synapse
    107506545 (CAMK4)
   04720 Long-term potentiation
    107506545 (CAMK4)
   04722 Neurotrophin signaling pathway
    107506545 (CAMK4)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    107506545 (CAMK4)
  09149 Aging
   04211 Longevity regulating pathway
    107506545 (CAMK4)
 09160 Human Diseases
  09162 Cancer: specific types
   05214 Glioma
    107506545 (CAMK4)
  09165 Substance dependence
   05031 Amphetamine addiction
    107506545 (CAMK4)
   05034 Alcoholism
    107506545 (CAMK4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ray01001]
    107506545 (CAMK4)
Enzymes [BR:ray01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     107506545 (CAMK4)
Protein kinases [BR:ray01001]
 Serine/threonine kinases: CAMK group
  CAMK1 family [OT]
   107506545 (CAMK4)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like FTA2 Kdo Pkinase_fungal YrbL-PhoP_reg APH Totivirus_coat
Other DBs
NCBI-GeneID: 107506545
NCBI-ProteinID: XP_015992737
LinkDB
Position
Unknown
AA seq 470 aa
MLKVTVPSCSASSCSSVTASVAPGAGTLVPDYWIDGSNRDALSDFFEVESELGRGATSIV
YRCKQKGTQKPYALKVLKKTVDKKIVRTEIGVLLRLSHPNIIKLKEIFETPTEISLVLEL
VTGGELFDRIVEKGYYSERDAADAVKQILEAVAYLHENGIVHRDLKPENLLYATPAPDAP
LKIADFGLSKIVEHQVLMKTVCGTPGYCAPEILRGCAYGPEVDMWSVGVITYILLCGFEP
FYDERGDQFMFRRILNCEYYFISPWWDEVSLNAKDLVKKLIVLDPKKRLTTFQALQHPWV
TGKAANFVHMDTAQKKLQEFNARRKLKAAVKAVVASSRLGSASSSHGSIQESQKASQEPS
PIQDGNEGVKAFPEGEKVQVDVAQVAVESAKAELMKGQEAEEVKDAAISAANPVKMVPEA
LEDGIKVADPEIEEGSVEEKLKTEEASKEGQENPALGVVAQQNDAILPEY
NT seq 1413 nt   +upstreamnt  +downstreamnt
atgctcaaagtcacggtgccctcgtgctcggcctcgtcctgttcttcggtcaccgccagt
gtggccccaggggccgggaccctcgtcccggattactggatcgacggctccaacagggat
gctttgagcgatttcttcgaggtggagtcggaactgggacggggagctacatccattgtg
tacagatgcaaacagaaggggacccagaagccttatgctctcaaagtgttaaagaaaaca
gtggacaaaaaaatcgtaagaactgaaataggagttcttcttcgcctctcacatccaaac
attataaaacttaaagagatatttgaaacccctacagaaatcagtctggtcctagaactt
gtcacaggaggagaactgtttgacaggattgtagaaaaaggatattatagtgaacgagat
gctgcagatgctgttaaacaaatcctggaggcagttgcttacctacatgaaaatggaatt
gtccatcgtgatctcaaaccagagaaccttctctatgcaactccagccccagatgcaccg
ctcaaaattgctgattttggactctctaaaattgtggaacatcaagtgctcatgaagaca
gtatgtggaaccccagggtactgcgcacctgaaattcttagaggctgtgcctatggaccc
gaggtggatatgtggtctgtaggagtcatcacctacatcttactttgtggattcgaacca
ttctatgatgaaagaggcgatcagttcatgttcaggagaattctgaattgtgaatattac
tttatctccccctggtgggatgaagtatctctaaatgccaaggacttggtcaaaaaatta
attgttttggatcctaagaaacggctgactaccttccaagctctgcagcacccgtgggtc
acaggtaaagcagccaattttgtacacatggataccgctcagaagaagctccaagaattc
aatgcccgacgcaagcttaaggcagcagtgaaggctgtggtggcctcatcacggttggga
agtgccagcagtagccacggcagcatccaggagagccaaaaggccagccaagagccatct
ccaatccaagacggcaatgaaggtgttaaagctttcccagaaggagagaaagttcaagtc
gatgtggcccaagtggcagttgagagtgcaaaggctgagctgatgaaggggcaggaggca
gaggaagttaaagatgctgctataagtgctgccaatcccgtcaagatggtgcccgaggca
ttagaggatgggataaaggtggccgacccggaaatagaagagggctcggtggaggagaag
ctgaagactgaggaagcctccaaagaagggcaagaaaatcctgctctgggtgttgttgct
cagcagaatgatgcgatcctgccagagtactaa

DBGET integrated database retrieval system