KEGG   Rousettus aegyptiacus (Egyptian rousette): 107506761
Entry
107506761         CDS       T06036                                 

Definition
(RefSeq) interferon omega-1-like
  KO
K05414  interferon alpha
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04060  Cytokine-cytokine receptor interaction
ray04151  PI3K-Akt signaling pathway
ray04217  Necroptosis
ray04620  Toll-like receptor signaling pathway
ray04621  NOD-like receptor signaling pathway
ray04622  RIG-I-like receptor signaling pathway
ray04623  Cytosolic DNA-sensing pathway
ray04630  JAK-STAT signaling pathway
ray04650  Natural killer cell mediated cytotoxicity
ray05152  Tuberculosis
ray05160  Hepatitis C
ray05161  Hepatitis B
ray05162  Measles
ray05163  Human cytomegalovirus infection
ray05164  Influenza A
ray05165  Human papillomavirus infection
ray05167  Kaposi sarcoma-associated herpesvirus infection
ray05168  Herpes simplex virus 1 infection
ray05169  Epstein-Barr virus infection
ray05170  Human immunodeficiency virus 1 infection
ray05171  Coronavirus disease - COVID-19
ray05200  Pathways in cancer
ray05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    107506761
   04151 PI3K-Akt signaling pathway
    107506761
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    107506761
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    107506761
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    107506761
   04621 NOD-like receptor signaling pathway
    107506761
   04622 RIG-I-like receptor signaling pathway
    107506761
   04623 Cytosolic DNA-sensing pathway
    107506761
   04650 Natural killer cell mediated cytotoxicity
    107506761
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107506761
  09163 Immune disease
   05320 Autoimmune thyroid disease
    107506761
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    107506761
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    107506761
   05161 Hepatitis B
    107506761
   05160 Hepatitis C
    107506761
   05171 Coronavirus disease - COVID-19
    107506761
   05164 Influenza A
    107506761
   05162 Measles
    107506761
   05168 Herpes simplex virus 1 infection
    107506761
   05163 Human cytomegalovirus infection
    107506761
   05167 Kaposi sarcoma-associated herpesvirus infection
    107506761
   05169 Epstein-Barr virus infection
    107506761
   05165 Human papillomavirus infection
    107506761
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ray04052]
    107506761
Cytokines and growth factors [BR:ray04052]
 Cytokines
  Interferons
   107506761
SSDB
Motif
Pfam: Interferon RNase_P_p30 SEO_C
Other DBs
NCBI-GeneID: 107506761
NCBI-ProteinID: XP_015993105
LinkDB
Position
Unknown
AA seq 171 aa
MAQRCSWLAAGAMLSSILVCSLAGDVPWMHSLENRKIVSLLRELEAMPSHLCLNDRTDFK
FPWERGNSAQVQKTRRTCFHHLMLQQIFHLLNAADSHAAWNRTLLSQLLSRLHHSLEQLD
RTNEGNLLCSDLDILVWKYFQGIHHYLKQKKYGTCAWEVVRVEITARLILM
NT seq 516 nt   +upstreamnt  +downstreamnt
atggcccagcgctgttcgtggctggcggctggagcgatgctcagctccatcctggtttgc
tctcttgctggagacgtgccttggatgcacagcctagaaaacaggaaaatcgtcagtctt
ttgagagagctggaagctatgccctctcacttgtgcctgaatgacagaaccgacttcaaa
tttccttgggaaagagggaatagcgcccaagtccagaagacacgacgcacctgtttccac
catctcatgctccagcagatcttccacctgttgaacgcggcggacagccatgctgcttgg
aaccgcaccctcctctctcaactactctctaggcttcatcacagcctagagcagctggac
cggacaaacgaaggaaatctgctttgctccgatttggacattcttgtctggaaatacttc
caaggaatccatcactatctgaaacaaaagaagtacggcacctgtgcttgggaagttgtc
agagtcgagatcacagcgcgccttattctcatgtga

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107507170
Entry
107507170         CDS       T06036                                 

Definition
(RefSeq) interferon alpha-1-like
  KO
K05414  interferon alpha
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04060  Cytokine-cytokine receptor interaction
ray04151  PI3K-Akt signaling pathway
ray04217  Necroptosis
ray04620  Toll-like receptor signaling pathway
ray04621  NOD-like receptor signaling pathway
ray04622  RIG-I-like receptor signaling pathway
ray04623  Cytosolic DNA-sensing pathway
ray04630  JAK-STAT signaling pathway
ray04650  Natural killer cell mediated cytotoxicity
ray05152  Tuberculosis
ray05160  Hepatitis C
ray05161  Hepatitis B
ray05162  Measles
ray05163  Human cytomegalovirus infection
ray05164  Influenza A
ray05165  Human papillomavirus infection
ray05167  Kaposi sarcoma-associated herpesvirus infection
ray05168  Herpes simplex virus 1 infection
ray05169  Epstein-Barr virus infection
ray05170  Human immunodeficiency virus 1 infection
ray05171  Coronavirus disease - COVID-19
ray05200  Pathways in cancer
ray05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    107507170
   04151 PI3K-Akt signaling pathway
    107507170
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    107507170
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    107507170
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    107507170
   04621 NOD-like receptor signaling pathway
    107507170
   04622 RIG-I-like receptor signaling pathway
    107507170
   04623 Cytosolic DNA-sensing pathway
    107507170
   04650 Natural killer cell mediated cytotoxicity
    107507170
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107507170
  09163 Immune disease
   05320 Autoimmune thyroid disease
    107507170
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    107507170
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    107507170
   05161 Hepatitis B
    107507170
   05160 Hepatitis C
    107507170
   05171 Coronavirus disease - COVID-19
    107507170
   05164 Influenza A
    107507170
   05162 Measles
    107507170
   05168 Herpes simplex virus 1 infection
    107507170
   05163 Human cytomegalovirus infection
    107507170
   05167 Kaposi sarcoma-associated herpesvirus infection
    107507170
   05169 Epstein-Barr virus infection
    107507170
   05165 Human papillomavirus infection
    107507170
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ray04052]
    107507170
Cytokines and growth factors [BR:ray04052]
 Cytokines
  Interferons
   107507170
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 107507170
NCBI-ProteinID: XP_015993691
LinkDB
Position
Unknown
AA seq 333 aa
MALPCSFLMAVVVLSCHSICSLGCDLPLTHSLVDRRALMLLGQMRRISPFSCLKDREDFG
FPQGVLHGNQFQEAEAIAVAHEVTRQTFLLFCTEASSAAWDETLRSRFCTGLHQQLNHLE
ACQTREVGAEETPLLDEDSALAVRSYFQRLILYLQEKKHSPCAWEIIRAEIMRSYSLSKL
FREELQRKQRSSLPYLRRARQKGDHSLSTKHPSTCYGTVGAARAARLEMELSGHWEPESL
PFWVNQEKRDKSGNMPPRISSIAKQSMCGCGHTSTLPPSPIPVLAAGKVPVMSSPAQKCS
EDWEPDQRVHTLHWQQMGEIICAPVQTLPCLIP
NT seq 1002 nt   +upstreamnt  +downstreamnt
atggccctgccctgttccttcctgatggccgtcgtggtgctcagctgccactccatctgc
tctctgggttgtgacctgcctctgacccacagcctggtcgacaggagggcgttgatgctt
ctgggacaaatgaggagaatctctcctttctcctgcctcaaggacagagaagactttgga
ttcccccagggggtgcttcatggcaaccagttccaggaggctgaagccatcgctgttgcc
cacgaggtgacccggcagaccttcctcctcttctgcacagaggcctcatccgcagcttgg
gatgagaccctgcgaagcagattctgcactggactccatcagcagctgaaccacctggaa
gcctgtcagacgcgggaggtgggggcggaggagactcccctgctggatgaggactccgca
ctggctgtgaggagttacttccagagactcatcctctatctgcaggagaagaaacacagc
ccttgtgcctgggagattatcagagcagagatcatgaggtcctactctttatcaaaactt
tttagagaagagctacaaagaaaacagaggtcaagtctcccataccttagaagagcaaga
cagaaaggtgaccacagcctctctacgaaacacccttccacgtgctatggaactgtgggg
gcagctagagctgcccgtctggaaatggaactcagtggccattgggagcctgaaagcctt
cctttctgggtaaatcaggagaagcgagataaatcaggaaatatgccaccaaggatttca
agcatcgccaaacaaagcatgtgcggatgtggccacacctccactctccctccctctcca
attcctgtgctggcagcgggcaaggtccctgtgatgtccagtcctgcacagaaatgcagt
gaagactgggagcccgaccaacgcgtccacacccttcactggcaacaaatgggggagatc
atctgtgcccctgttcagacacttccatgtctgattccatga

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107507171
Entry
107507171         CDS       T06036                                 

Definition
(RefSeq) interferon alpha-1-like
  KO
K05414  interferon alpha
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04060  Cytokine-cytokine receptor interaction
ray04151  PI3K-Akt signaling pathway
ray04217  Necroptosis
ray04620  Toll-like receptor signaling pathway
ray04621  NOD-like receptor signaling pathway
ray04622  RIG-I-like receptor signaling pathway
ray04623  Cytosolic DNA-sensing pathway
ray04630  JAK-STAT signaling pathway
ray04650  Natural killer cell mediated cytotoxicity
ray05152  Tuberculosis
ray05160  Hepatitis C
ray05161  Hepatitis B
ray05162  Measles
ray05163  Human cytomegalovirus infection
ray05164  Influenza A
ray05165  Human papillomavirus infection
ray05167  Kaposi sarcoma-associated herpesvirus infection
ray05168  Herpes simplex virus 1 infection
ray05169  Epstein-Barr virus infection
ray05170  Human immunodeficiency virus 1 infection
ray05171  Coronavirus disease - COVID-19
ray05200  Pathways in cancer
ray05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    107507171
   04151 PI3K-Akt signaling pathway
    107507171
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    107507171
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    107507171
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    107507171
   04621 NOD-like receptor signaling pathway
    107507171
   04622 RIG-I-like receptor signaling pathway
    107507171
   04623 Cytosolic DNA-sensing pathway
    107507171
   04650 Natural killer cell mediated cytotoxicity
    107507171
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107507171
  09163 Immune disease
   05320 Autoimmune thyroid disease
    107507171
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    107507171
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    107507171
   05161 Hepatitis B
    107507171
   05160 Hepatitis C
    107507171
   05171 Coronavirus disease - COVID-19
    107507171
   05164 Influenza A
    107507171
   05162 Measles
    107507171
   05168 Herpes simplex virus 1 infection
    107507171
   05163 Human cytomegalovirus infection
    107507171
   05167 Kaposi sarcoma-associated herpesvirus infection
    107507171
   05169 Epstein-Barr virus infection
    107507171
   05165 Human papillomavirus infection
    107507171
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ray04052]
    107507171
Cytokines and growth factors [BR:ray04052]
 Cytokines
  Interferons
   107507171
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 107507171
NCBI-ProteinID: XP_015993692
LinkDB
Position
Unknown
AA seq 189 aa
MALPCSFLMAVVVLSCHSICSLGCDLPLTHSLDNRRALMLLGQMRRISPFSCLKDREDFG
FPQGVLHGNQLQEAQAIAVAHEVTWQTFLLFCTEASSAAWDETLRSRFCTGLHQQLIDLE
ACQTREVGAEETPLLDEDSTRAVRSYFQRLFLYLQEKKHSPCAWEIIRAEIMSSYSLSTH
LKETSRSKD
NT seq 570 nt   +upstreamnt  +downstreamnt
atggccctgccctgttccttcctgatggccgtcgtggtgctcagctgccactccatctgc
tctctgggttgtgacctgcctctgacccacagcctggacaacaggagggcgttgatgctt
ctgggacaaatgaggagaatctctcctttctcctgcctcaaggacagagaagactttgga
ttcccccagggggtgcttcatggcaaccagctccaggaggctcaagccatcgctgttgcc
cacgaggtgacctggcagaccttcctcctcttctgcacagaggcctcatccgcagcttgg
gatgagaccctgcgaagcagattctgcactggactccatcagcagctgatcgacctggaa
gcctgtcagacgcgggaggtgggggcggaggagactcccctgctggatgaggactccaca
cgggctgtgaggagttacttccagagactcttcctctatctgcaggagaagaaacacagc
ccttgtgcctgggagattatcagagcagagatcatgagctcctactctttatcaacacac
ttgaaggaaacatcaaggagtaaggattga

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107507173
Entry
107507173         CDS       T06036                                 

Definition
(RefSeq) interferon omega-1-like
  KO
K05414  interferon alpha
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04060  Cytokine-cytokine receptor interaction
ray04151  PI3K-Akt signaling pathway
ray04217  Necroptosis
ray04620  Toll-like receptor signaling pathway
ray04621  NOD-like receptor signaling pathway
ray04622  RIG-I-like receptor signaling pathway
ray04623  Cytosolic DNA-sensing pathway
ray04630  JAK-STAT signaling pathway
ray04650  Natural killer cell mediated cytotoxicity
ray05152  Tuberculosis
ray05160  Hepatitis C
ray05161  Hepatitis B
ray05162  Measles
ray05163  Human cytomegalovirus infection
ray05164  Influenza A
ray05165  Human papillomavirus infection
ray05167  Kaposi sarcoma-associated herpesvirus infection
ray05168  Herpes simplex virus 1 infection
ray05169  Epstein-Barr virus infection
ray05170  Human immunodeficiency virus 1 infection
ray05171  Coronavirus disease - COVID-19
ray05200  Pathways in cancer
ray05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    107507173
   04151 PI3K-Akt signaling pathway
    107507173
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    107507173
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    107507173
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    107507173
   04621 NOD-like receptor signaling pathway
    107507173
   04622 RIG-I-like receptor signaling pathway
    107507173
   04623 Cytosolic DNA-sensing pathway
    107507173
   04650 Natural killer cell mediated cytotoxicity
    107507173
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107507173
  09163 Immune disease
   05320 Autoimmune thyroid disease
    107507173
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    107507173
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    107507173
   05161 Hepatitis B
    107507173
   05160 Hepatitis C
    107507173
   05171 Coronavirus disease - COVID-19
    107507173
   05164 Influenza A
    107507173
   05162 Measles
    107507173
   05168 Herpes simplex virus 1 infection
    107507173
   05163 Human cytomegalovirus infection
    107507173
   05167 Kaposi sarcoma-associated herpesvirus infection
    107507173
   05169 Epstein-Barr virus infection
    107507173
   05165 Human papillomavirus infection
    107507173
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ray04052]
    107507173
Cytokines and growth factors [BR:ray04052]
 Cytokines
  Interferons
   107507173
SSDB
Motif
Pfam: Interferon RNase_P_p30
Other DBs
NCBI-GeneID: 107507173
NCBI-ProteinID: XP_015993694
LinkDB
Position
Unknown
AA seq 171 aa
MAQRCSWLAAGAMLSSILVCSLAGDVPWMHSLENRKIVSLLRELEAMPSHLCLNDRTDFK
LPWERGNSAQVQKTRRTCFHHLMLQQIFHLLNAADSHAAWNRTLLSQLLSRLHHSLEQLD
RTNEGNLLCSDLDILVWKYFQGIHHYLKQKKYGTCAWEVVRVEITARLILM
NT seq 516 nt   +upstreamnt  +downstreamnt
atggcccagcgctgttcgtggctggcggctggagcgatgctcagctccatcctggtttgc
tctcttgctggagacgtgccttggatgcacagcctagaaaacaggaaaatcgtcagtctt
ttgagagagctggaagctatgccctctcacttgtgcctgaatgacagaaccgacttcaaa
cttccttgggaaagagggaatagcgcccaagtccagaagacacgacgcacctgtttccac
catctcatgctccagcagatcttccacctgttgaacgcggcggacagccatgctgcttgg
aaccgcaccctcctctctcaactactctctaggcttcatcacagcctagagcagctggac
cggacaaacgaaggaaatctgctttgctccgatttggacattcttgtctggaaatacttc
caaggaatccatcactatctgaaacaaaagaagtacggcacctgtgcttgggaagttgtc
agagtcgagatcacagcgcgccttattctcatgtga

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107507175
Entry
107507175         CDS       T06036                                 

Definition
(RefSeq) interferon alpha-1-like
  KO
K05414  interferon alpha
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04060  Cytokine-cytokine receptor interaction
ray04151  PI3K-Akt signaling pathway
ray04217  Necroptosis
ray04620  Toll-like receptor signaling pathway
ray04621  NOD-like receptor signaling pathway
ray04622  RIG-I-like receptor signaling pathway
ray04623  Cytosolic DNA-sensing pathway
ray04630  JAK-STAT signaling pathway
ray04650  Natural killer cell mediated cytotoxicity
ray05152  Tuberculosis
ray05160  Hepatitis C
ray05161  Hepatitis B
ray05162  Measles
ray05163  Human cytomegalovirus infection
ray05164  Influenza A
ray05165  Human papillomavirus infection
ray05167  Kaposi sarcoma-associated herpesvirus infection
ray05168  Herpes simplex virus 1 infection
ray05169  Epstein-Barr virus infection
ray05170  Human immunodeficiency virus 1 infection
ray05171  Coronavirus disease - COVID-19
ray05200  Pathways in cancer
ray05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    107507175
   04151 PI3K-Akt signaling pathway
    107507175
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    107507175
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    107507175
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    107507175
   04621 NOD-like receptor signaling pathway
    107507175
   04622 RIG-I-like receptor signaling pathway
    107507175
   04623 Cytosolic DNA-sensing pathway
    107507175
   04650 Natural killer cell mediated cytotoxicity
    107507175
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107507175
  09163 Immune disease
   05320 Autoimmune thyroid disease
    107507175
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    107507175
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    107507175
   05161 Hepatitis B
    107507175
   05160 Hepatitis C
    107507175
   05171 Coronavirus disease - COVID-19
    107507175
   05164 Influenza A
    107507175
   05162 Measles
    107507175
   05168 Herpes simplex virus 1 infection
    107507175
   05163 Human cytomegalovirus infection
    107507175
   05167 Kaposi sarcoma-associated herpesvirus infection
    107507175
   05169 Epstein-Barr virus infection
    107507175
   05165 Human papillomavirus infection
    107507175
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ray04052]
    107507175
Cytokines and growth factors [BR:ray04052]
 Cytokines
  Interferons
   107507175
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 107507175
NCBI-ProteinID: XP_015993695
LinkDB
Position
Unknown
AA seq 189 aa
MALPCSFLMAVVVLSCHSICSLGCDLPLTHSLVDRRALMLLGQMRRISPFSCLKDREDFG
FPQGVLHGNQLQEAQAIAVAHEVTRQTFLLFCTEASSAAWDETLRSRFCTGLHQQLNDLE
ACRTREVGAEETPLLDEDSTLAVRSYFQRLFLYLQEKKHSPCAWEIIRAEIMSSYSLSTH
LKETSRSKD
NT seq 570 nt   +upstreamnt  +downstreamnt
atggccctgccctgttccttcctgatggccgtggtggtgctcagctgccactccatctgc
tctctgggttgtgacctgcctctgacccacagcctggtcgacaggagggcgttgatgctt
ctgggacaaatgaggagaatctctcctttctcctgcctcaaggacagagaagactttgga
ttcccccagggggtgcttcatggcaaccagctccaggaggctcaagccatcgctgttgcc
cacgaggtgacccggcagaccttcctcctcttctgcacagaggcctcatccgcagcttgg
gatgagaccctgcgaagcagattctgcactggactccatcagcagctgaacgacctggaa
gcctgtcggacgcgggaggtgggggcggaggagactcccctgctggatgaggactccaca
ctggctgtgaggagttacttccagagactcttcctctatctgcaggagaagaaacacagc
ccttgtgcctgggagattatcagagcagagatcatgagctcctactctttatcaacacac
ttgaaggaaacatcaaggagtaaggattga

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107507179
Entry
107507179         CDS       T06036                                 

Definition
(RefSeq) interferon omega-1-like
  KO
K05414  interferon alpha
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04060  Cytokine-cytokine receptor interaction
ray04151  PI3K-Akt signaling pathway
ray04217  Necroptosis
ray04620  Toll-like receptor signaling pathway
ray04621  NOD-like receptor signaling pathway
ray04622  RIG-I-like receptor signaling pathway
ray04623  Cytosolic DNA-sensing pathway
ray04630  JAK-STAT signaling pathway
ray04650  Natural killer cell mediated cytotoxicity
ray05152  Tuberculosis
ray05160  Hepatitis C
ray05161  Hepatitis B
ray05162  Measles
ray05163  Human cytomegalovirus infection
ray05164  Influenza A
ray05165  Human papillomavirus infection
ray05167  Kaposi sarcoma-associated herpesvirus infection
ray05168  Herpes simplex virus 1 infection
ray05169  Epstein-Barr virus infection
ray05170  Human immunodeficiency virus 1 infection
ray05171  Coronavirus disease - COVID-19
ray05200  Pathways in cancer
ray05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    107507179
   04151 PI3K-Akt signaling pathway
    107507179
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    107507179
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    107507179
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    107507179
   04621 NOD-like receptor signaling pathway
    107507179
   04622 RIG-I-like receptor signaling pathway
    107507179
   04623 Cytosolic DNA-sensing pathway
    107507179
   04650 Natural killer cell mediated cytotoxicity
    107507179
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107507179
  09163 Immune disease
   05320 Autoimmune thyroid disease
    107507179
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    107507179
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    107507179
   05161 Hepatitis B
    107507179
   05160 Hepatitis C
    107507179
   05171 Coronavirus disease - COVID-19
    107507179
   05164 Influenza A
    107507179
   05162 Measles
    107507179
   05168 Herpes simplex virus 1 infection
    107507179
   05163 Human cytomegalovirus infection
    107507179
   05167 Kaposi sarcoma-associated herpesvirus infection
    107507179
   05169 Epstein-Barr virus infection
    107507179
   05165 Human papillomavirus infection
    107507179
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ray04052]
    107507179
Cytokines and growth factors [BR:ray04052]
 Cytokines
  Interferons
   107507179
SSDB
Motif
Pfam: Interferon SEO_C RNase_P_p30
Other DBs
NCBI-GeneID: 107507179
NCBI-ProteinID: XP_015993699
LinkDB
Position
Unknown
AA seq 171 aa
MAPRCSWLAAGAMLSSILVCSLAGDVPWMHSLENRKIVSLLRELEAMPSHLCLNDRTDFK
FSWERGNSAQVQKTRRTCFHHLMLQQIFHLLNAADSHAAWNRTLLSQLLSRLHHSLEQLD
RTNEGNLLCSDLDILVWKYFQGIHHYLKQKKYGTCAWEVVRVEITARLILM
NT seq 516 nt   +upstreamnt  +downstreamnt
atggctccgcgctgttcgtggctggcggccggagcgatgctcagctccatcctggtttgc
tcccttgctggagacgtgccttggatgcacagcctagaaaacaggaaaatcgtcagtctt
ttgagagagctggaagctatgccctctcacttgtgcctgaatgacagaaccgacttcaaa
ttttcttgggaaagagggaatagcgcccaagtccagaagacacgacgcacctgtttccac
catctcatgctccagcagatcttccacctgttgaacgcggcggacagccatgctgcttgg
aaccgcaccctcctctctcaactactctctaggcttcatcacagcctagagcagctggac
cggacaaacgaaggaaatctgctttgttccgatttggacattcttgtctggaaatacttc
caaggaatccatcactatctgaaacaaaagaagtacggcacctgtgcttgggaagttgtc
agagtcgagatcacagcgcgccttattctcatgtga

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107507611
Entry
107507611         CDS       T06036                                 

Definition
(RefSeq) interferon alpha-1-like
  KO
K05414  interferon alpha
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04060  Cytokine-cytokine receptor interaction
ray04151  PI3K-Akt signaling pathway
ray04217  Necroptosis
ray04620  Toll-like receptor signaling pathway
ray04621  NOD-like receptor signaling pathway
ray04622  RIG-I-like receptor signaling pathway
ray04623  Cytosolic DNA-sensing pathway
ray04630  JAK-STAT signaling pathway
ray04650  Natural killer cell mediated cytotoxicity
ray05152  Tuberculosis
ray05160  Hepatitis C
ray05161  Hepatitis B
ray05162  Measles
ray05163  Human cytomegalovirus infection
ray05164  Influenza A
ray05165  Human papillomavirus infection
ray05167  Kaposi sarcoma-associated herpesvirus infection
ray05168  Herpes simplex virus 1 infection
ray05169  Epstein-Barr virus infection
ray05170  Human immunodeficiency virus 1 infection
ray05171  Coronavirus disease - COVID-19
ray05200  Pathways in cancer
ray05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    107507611
   04151 PI3K-Akt signaling pathway
    107507611
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    107507611
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    107507611
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    107507611
   04621 NOD-like receptor signaling pathway
    107507611
   04622 RIG-I-like receptor signaling pathway
    107507611
   04623 Cytosolic DNA-sensing pathway
    107507611
   04650 Natural killer cell mediated cytotoxicity
    107507611
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107507611
  09163 Immune disease
   05320 Autoimmune thyroid disease
    107507611
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    107507611
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    107507611
   05161 Hepatitis B
    107507611
   05160 Hepatitis C
    107507611
   05171 Coronavirus disease - COVID-19
    107507611
   05164 Influenza A
    107507611
   05162 Measles
    107507611
   05168 Herpes simplex virus 1 infection
    107507611
   05163 Human cytomegalovirus infection
    107507611
   05167 Kaposi sarcoma-associated herpesvirus infection
    107507611
   05169 Epstein-Barr virus infection
    107507611
   05165 Human papillomavirus infection
    107507611
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ray04052]
    107507611
Cytokines and growth factors [BR:ray04052]
 Cytokines
  Interferons
   107507611
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 107507611
NCBI-ProteinID: XP_015994212
LinkDB
Position
Unknown
AA seq 313 aa
MALPCSFLMAVVVLSCHSICSLGDLPLTHSLVDRRALMLLGQMRRISPFSCLKDREDFGF
PQGVLHGNQFQEAQAIAVAHEVTRQTFLLFCTEASSAAWDETLRSRFCTGLYQQLNHLEA
CQTREVGAEETPLLDEDSALAVRSYFQRLILYLQEKKHSPCAWEIIRAEIMRSYSLSKLF
REELQRKQRPQPLYETPVPRAMELWGQLELPVWKWNSVANAAGLTCAQRQQRTSRNEKKM
KVSSRLRTVKEYREVYGVDFNRQALGGGKIPMGSTESEVSPDYSYSDGEESHVDSLSTNF
SHRDVANSSVPGP
NT seq 942 nt   +upstreamnt  +downstreamnt
atggccctgccctgttccttcctgatggccgtcgtggtgctcagctgccactccatctgc
tctctgggtgacctgcctctgacccacagcctggtcgacaggagggcgttgatgcttctg
ggacaaatgaggagaatctctcctttctcctgcctcaaggacagagaagactttggattc
ccccagggggtgcttcatggcaaccagttccaggaggctcaagccatcgctgttgcccac
gaggtgacccggcagaccttcctcctcttctgcacagaggcctcatccgcagcttgggat
gagaccctgcgaagcagattctgcactggactctatcagcagctgaaccacctggaagcc
tgtcagacgcgggaggtgggggcggaggagactcccctgctggatgaggactccgcactg
gctgtgaggagttacttccagagactcatcctctatctgcaggagaagaaacacagccct
tgtgcctgggagattatcagagcagagatcatgaggtcctactctttatcaaaacttttt
agagaagagctacaaagaaaacagagaccacagcctctctacgaaacacctgttccacgt
gctatggaactgtgggggcagctagagctgcccgtctggaaatggaactcagtggcgaat
gctgcgggactcacgtgtgctcaaaggcaacagcgcacatctagaaacgagaagaagatg
aaagtcagcagcagattgaggaccgtgaaagaatacagagaggtttatggtgtggacttc
aacaggcaggccctagggggtggaaagattccaatgggcagcacggagtcagaggtttct
ccagattattcctattcagacggggaggagagtcatgtggattccctgagcacaaacttc
tcccaccgagatgtggccaatagcagtgtccccgggccgtga

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107507612
Entry
107507612         CDS       T06036                                 

Definition
(RefSeq) interferon omega-1-like
  KO
K05414  interferon alpha
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04060  Cytokine-cytokine receptor interaction
ray04151  PI3K-Akt signaling pathway
ray04217  Necroptosis
ray04620  Toll-like receptor signaling pathway
ray04621  NOD-like receptor signaling pathway
ray04622  RIG-I-like receptor signaling pathway
ray04623  Cytosolic DNA-sensing pathway
ray04630  JAK-STAT signaling pathway
ray04650  Natural killer cell mediated cytotoxicity
ray05152  Tuberculosis
ray05160  Hepatitis C
ray05161  Hepatitis B
ray05162  Measles
ray05163  Human cytomegalovirus infection
ray05164  Influenza A
ray05165  Human papillomavirus infection
ray05167  Kaposi sarcoma-associated herpesvirus infection
ray05168  Herpes simplex virus 1 infection
ray05169  Epstein-Barr virus infection
ray05170  Human immunodeficiency virus 1 infection
ray05171  Coronavirus disease - COVID-19
ray05200  Pathways in cancer
ray05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    107507612
   04151 PI3K-Akt signaling pathway
    107507612
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    107507612
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    107507612
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    107507612
   04621 NOD-like receptor signaling pathway
    107507612
   04622 RIG-I-like receptor signaling pathway
    107507612
   04623 Cytosolic DNA-sensing pathway
    107507612
   04650 Natural killer cell mediated cytotoxicity
    107507612
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107507612
  09163 Immune disease
   05320 Autoimmune thyroid disease
    107507612
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    107507612
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    107507612
   05161 Hepatitis B
    107507612
   05160 Hepatitis C
    107507612
   05171 Coronavirus disease - COVID-19
    107507612
   05164 Influenza A
    107507612
   05162 Measles
    107507612
   05168 Herpes simplex virus 1 infection
    107507612
   05163 Human cytomegalovirus infection
    107507612
   05167 Kaposi sarcoma-associated herpesvirus infection
    107507612
   05169 Epstein-Barr virus infection
    107507612
   05165 Human papillomavirus infection
    107507612
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ray04052]
    107507612
Cytokines and growth factors [BR:ray04052]
 Cytokines
  Interferons
   107507612
SSDB
Motif
Pfam: Interferon RNase_P_p30
Other DBs
NCBI-GeneID: 107507612
NCBI-ProteinID: XP_015994213
LinkDB
Position
Unknown
AA seq 171 aa
MAQRCSWLAAGAMLSSILVCSLAGDVPWMHSLENRKIVSLLRELEAMPSHLCLNDRTDFK
LPWERGNSAQVQKTRRTCFHHLMLQQIFHLLNAADSHAAWNRTLLSQLLSRLHHSLEQLD
RTNEGNLLCSDLDILVWKYFQGIHHYLKQKKYGTCAWEVVRVEITARLILM
NT seq 516 nt   +upstreamnt  +downstreamnt
atggcccagcgctgttcgtggctggcggccggagcgatgctcagctccatcctggtttgc
tctcttgctggagacgtgccttggatgcacagcctagaaaacaggaaaatcgtcagtctt
ttgagagagctggaagctatgccctctcacttgtgcctgaatgacagaaccgacttcaaa
cttccttgggaaagagggaatagcgcccaagtccagaagacacgacgcacctgtttccac
catctcatgctccagcagatcttccacctgttgaacgcggcggacagccatgctgcttgg
aaccgcaccctcctctctcaactactctctaggcttcatcacagcctagagcagctggac
cggacaaacgaaggaaatctgctttgctccgatttggacattcttgtctggaaatacttc
caaggaatccatcactatctgaaacaaaagaagtacggcacctgtgcttgggaagttgtc
agagtcgagatcacagcgcgccttattctcatgtga

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107507614
Entry
107507614         CDS       T06036                                 

Definition
(RefSeq) interferon alpha-1-like
  KO
K05414  interferon alpha
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04060  Cytokine-cytokine receptor interaction
ray04151  PI3K-Akt signaling pathway
ray04217  Necroptosis
ray04620  Toll-like receptor signaling pathway
ray04621  NOD-like receptor signaling pathway
ray04622  RIG-I-like receptor signaling pathway
ray04623  Cytosolic DNA-sensing pathway
ray04630  JAK-STAT signaling pathway
ray04650  Natural killer cell mediated cytotoxicity
ray05152  Tuberculosis
ray05160  Hepatitis C
ray05161  Hepatitis B
ray05162  Measles
ray05163  Human cytomegalovirus infection
ray05164  Influenza A
ray05165  Human papillomavirus infection
ray05167  Kaposi sarcoma-associated herpesvirus infection
ray05168  Herpes simplex virus 1 infection
ray05169  Epstein-Barr virus infection
ray05170  Human immunodeficiency virus 1 infection
ray05171  Coronavirus disease - COVID-19
ray05200  Pathways in cancer
ray05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    107507614
   04151 PI3K-Akt signaling pathway
    107507614
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    107507614
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    107507614
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    107507614
   04621 NOD-like receptor signaling pathway
    107507614
   04622 RIG-I-like receptor signaling pathway
    107507614
   04623 Cytosolic DNA-sensing pathway
    107507614
   04650 Natural killer cell mediated cytotoxicity
    107507614
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107507614
  09163 Immune disease
   05320 Autoimmune thyroid disease
    107507614
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    107507614
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    107507614
   05161 Hepatitis B
    107507614
   05160 Hepatitis C
    107507614
   05171 Coronavirus disease - COVID-19
    107507614
   05164 Influenza A
    107507614
   05162 Measles
    107507614
   05168 Herpes simplex virus 1 infection
    107507614
   05163 Human cytomegalovirus infection
    107507614
   05167 Kaposi sarcoma-associated herpesvirus infection
    107507614
   05169 Epstein-Barr virus infection
    107507614
   05165 Human papillomavirus infection
    107507614
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ray04052]
    107507614
Cytokines and growth factors [BR:ray04052]
 Cytokines
  Interferons
   107507614
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 107507614
NCBI-ProteinID: XP_015994216
LinkDB
Position
Unknown
AA seq 189 aa
MALPCSFLMAVVVLSCHSICSLGCDLPLTHSLVDRRALMLLGQMRRISPFSCLKDREDFG
FPQGVLHGNQLQEAQAIAVAHEVTRQTFLLFCTEASSAAWDETLRSRFCTGLHQQLIDLE
ACQTREVGAEETPLLDEDSTRAVRSYFQRLFLYLQEKKHSPCAWEIIRAEIMSSYSLSTH
LKETSRSKD
NT seq 570 nt   +upstreamnt  +downstreamnt
atggccctgccctgttccttcctgatggccgtggtggtgctcagctgccactccatctgc
tctctgggttgtgacctgcctctgacccacagcctggtcgacaggagggcgttgatgctt
ctgggacaaatgaggagaatctctcctttctcctgcctcaaggacagagaagactttgga
ttcccccagggggtgcttcatggcaaccagctccaggaggctcaagccatcgctgttgcc
cacgaggtgacccggcagaccttcctcctcttctgcacagaggcctcatccgcagcttgg
gatgagaccctgcgaagcagattctgcactggactccatcagcagctgatcgacctggaa
gcctgtcagacgcgggaggtgggggcggaggagactcccctgctggatgaggactccaca
cgggctgtgaggagttacttccagagactcttcctctatctgcaggagaagaaacacagc
ccttgtgcctgggagattatcagagcagagatcatgagctcctactctttatcaacacac
ttgaaggaaacatcaaggagtaaggattga

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107508426
Entry
107508426         CDS       T06036                                 

Definition
(RefSeq) interferon alpha-1-like
  KO
K05414  interferon alpha
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04060  Cytokine-cytokine receptor interaction
ray04151  PI3K-Akt signaling pathway
ray04217  Necroptosis
ray04620  Toll-like receptor signaling pathway
ray04621  NOD-like receptor signaling pathway
ray04622  RIG-I-like receptor signaling pathway
ray04623  Cytosolic DNA-sensing pathway
ray04630  JAK-STAT signaling pathway
ray04650  Natural killer cell mediated cytotoxicity
ray05152  Tuberculosis
ray05160  Hepatitis C
ray05161  Hepatitis B
ray05162  Measles
ray05163  Human cytomegalovirus infection
ray05164  Influenza A
ray05165  Human papillomavirus infection
ray05167  Kaposi sarcoma-associated herpesvirus infection
ray05168  Herpes simplex virus 1 infection
ray05169  Epstein-Barr virus infection
ray05170  Human immunodeficiency virus 1 infection
ray05171  Coronavirus disease - COVID-19
ray05200  Pathways in cancer
ray05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    107508426
   04151 PI3K-Akt signaling pathway
    107508426
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    107508426
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    107508426
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    107508426
   04621 NOD-like receptor signaling pathway
    107508426
   04622 RIG-I-like receptor signaling pathway
    107508426
   04623 Cytosolic DNA-sensing pathway
    107508426
   04650 Natural killer cell mediated cytotoxicity
    107508426
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107508426
  09163 Immune disease
   05320 Autoimmune thyroid disease
    107508426
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    107508426
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    107508426
   05161 Hepatitis B
    107508426
   05160 Hepatitis C
    107508426
   05171 Coronavirus disease - COVID-19
    107508426
   05164 Influenza A
    107508426
   05162 Measles
    107508426
   05168 Herpes simplex virus 1 infection
    107508426
   05163 Human cytomegalovirus infection
    107508426
   05167 Kaposi sarcoma-associated herpesvirus infection
    107508426
   05169 Epstein-Barr virus infection
    107508426
   05165 Human papillomavirus infection
    107508426
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ray04052]
    107508426
Cytokines and growth factors [BR:ray04052]
 Cytokines
  Interferons
   107508426
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 107508426
NCBI-ProteinID: XP_015995690
LinkDB
Position
Unknown
AA seq 189 aa
MALPCSFLMAVVVLSCHSICSLGCDLPLTHSLVDRRALMLLGQMRRISPFSCLKDREDFG
FPQGVLHGNQLQEAQAIAVAHEVTRQTFLLFCTEASSAAWDETLRSRFCTGLHQQLIDLE
ACRTREVGAEETPLLDEDSTRAVRSYFQRLFLYLQEKKHSPCAWEIIRAEIMSSYSLSTH
LKETSRSKD
NT seq 570 nt   +upstreamnt  +downstreamnt
atggccctgccctgttccttcctgatggccgtcgtggtgctcagctgccactccatctgc
tctctgggttgtgacctgcctctgacccacagcctggtcgacaggagggcgttgatgctt
ctgggacaaatgaggagaatctctcctttctcctgcctcaaggacagagaagactttgga
ttcccccagggggtgcttcatggcaaccagctccaggaggctcaagccatcgctgttgcc
cacgaggtgacccggcagaccttcctcctcttctgcacagaggcctcatccgcagcttgg
gatgagaccctgcgaagcagattctgcactggactccatcagcagctgatcgacctggaa
gcctgtcggacgcgggaggtgggggcggaggagactcccctgctggatgaggactccaca
cgggctgtgaggagttacttccagagactcttcctctatctgcaggagaagaaacacagc
ccttgtgcctgggagattatcagagcagagatcatgagctcctactctttatcaacacac
ttgaaggaaacatcaaggagtaaggattga

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107508852
Entry
107508852         CDS       T06036                                 

Definition
(RefSeq) interferon alpha-1-like
  KO
K05414  interferon alpha
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04060  Cytokine-cytokine receptor interaction
ray04151  PI3K-Akt signaling pathway
ray04217  Necroptosis
ray04620  Toll-like receptor signaling pathway
ray04621  NOD-like receptor signaling pathway
ray04622  RIG-I-like receptor signaling pathway
ray04623  Cytosolic DNA-sensing pathway
ray04630  JAK-STAT signaling pathway
ray04650  Natural killer cell mediated cytotoxicity
ray05152  Tuberculosis
ray05160  Hepatitis C
ray05161  Hepatitis B
ray05162  Measles
ray05163  Human cytomegalovirus infection
ray05164  Influenza A
ray05165  Human papillomavirus infection
ray05167  Kaposi sarcoma-associated herpesvirus infection
ray05168  Herpes simplex virus 1 infection
ray05169  Epstein-Barr virus infection
ray05170  Human immunodeficiency virus 1 infection
ray05171  Coronavirus disease - COVID-19
ray05200  Pathways in cancer
ray05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    107508852
   04151 PI3K-Akt signaling pathway
    107508852
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    107508852
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    107508852
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    107508852
   04621 NOD-like receptor signaling pathway
    107508852
   04622 RIG-I-like receptor signaling pathway
    107508852
   04623 Cytosolic DNA-sensing pathway
    107508852
   04650 Natural killer cell mediated cytotoxicity
    107508852
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107508852
  09163 Immune disease
   05320 Autoimmune thyroid disease
    107508852
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    107508852
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    107508852
   05161 Hepatitis B
    107508852
   05160 Hepatitis C
    107508852
   05171 Coronavirus disease - COVID-19
    107508852
   05164 Influenza A
    107508852
   05162 Measles
    107508852
   05168 Herpes simplex virus 1 infection
    107508852
   05163 Human cytomegalovirus infection
    107508852
   05167 Kaposi sarcoma-associated herpesvirus infection
    107508852
   05169 Epstein-Barr virus infection
    107508852
   05165 Human papillomavirus infection
    107508852
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ray04052]
    107508852
Cytokines and growth factors [BR:ray04052]
 Cytokines
  Interferons
   107508852
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 107508852
NCBI-ProteinID: XP_015996357
LinkDB
Position
Unknown
AA seq 189 aa
MALPCSFLMAVVVLSCHSICSLGCDLPLTHSLVDRRALMLLGQMRRISPFSCLKDREDFG
FPQGVLHGNQFQEAQAIAVAHEVTRQTFLLFCTEASSAAWDETLRSRFCTGLHQQLNHLE
ACQTREVGAEETPLLDEDSTLAVRSYFQRLFLYLQEKKHSPCAWEIIRAEIMSSYSLSTH
LKETSKSKD
NT seq 570 nt   +upstreamnt  +downstreamnt
atggccctgccctgttccttcctgatggccgtcgtggtgctcagctgccactccatctgc
tctctgggttgtgacctgcctctgacccacagcctggtcgacaggagggcgttgatgctt
ctgggacaaatgaggagaatctctcctttctcctgcctcaaggacagagaagactttgga
ttcccccagggggtgcttcatggcaaccagttccaggaggctcaagccatcgctgttgcc
cacgaggtgacccggcagaccttcctcctcttctgcacagaggcctcatccgcagcttgg
gatgagaccctgcgaagcagattctgcactggactccatcagcagctgaaccacctggaa
gcctgtcagacgcgggaggtgggggcggaggagactcccctgctggatgaggactccaca
ctggctgtgaggagttacttccagagactcttcctctatctgcaggagaagaaacacagc
ccttgtgcctgggagattatcagagcagagatcatgagctcctactctttatcaacacac
ttgaaggaaacatcaaagagtaaggattga

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107509253
Entry
107509253         CDS       T06036                                 

Definition
(RefSeq) interferon alpha-1-like
  KO
K05414  interferon alpha
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04060  Cytokine-cytokine receptor interaction
ray04151  PI3K-Akt signaling pathway
ray04217  Necroptosis
ray04620  Toll-like receptor signaling pathway
ray04621  NOD-like receptor signaling pathway
ray04622  RIG-I-like receptor signaling pathway
ray04623  Cytosolic DNA-sensing pathway
ray04630  JAK-STAT signaling pathway
ray04650  Natural killer cell mediated cytotoxicity
ray05152  Tuberculosis
ray05160  Hepatitis C
ray05161  Hepatitis B
ray05162  Measles
ray05163  Human cytomegalovirus infection
ray05164  Influenza A
ray05165  Human papillomavirus infection
ray05167  Kaposi sarcoma-associated herpesvirus infection
ray05168  Herpes simplex virus 1 infection
ray05169  Epstein-Barr virus infection
ray05170  Human immunodeficiency virus 1 infection
ray05171  Coronavirus disease - COVID-19
ray05200  Pathways in cancer
ray05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    107509253
   04151 PI3K-Akt signaling pathway
    107509253
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    107509253
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    107509253
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    107509253
   04621 NOD-like receptor signaling pathway
    107509253
   04622 RIG-I-like receptor signaling pathway
    107509253
   04623 Cytosolic DNA-sensing pathway
    107509253
   04650 Natural killer cell mediated cytotoxicity
    107509253
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107509253
  09163 Immune disease
   05320 Autoimmune thyroid disease
    107509253
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    107509253
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    107509253
   05161 Hepatitis B
    107509253
   05160 Hepatitis C
    107509253
   05171 Coronavirus disease - COVID-19
    107509253
   05164 Influenza A
    107509253
   05162 Measles
    107509253
   05168 Herpes simplex virus 1 infection
    107509253
   05163 Human cytomegalovirus infection
    107509253
   05167 Kaposi sarcoma-associated herpesvirus infection
    107509253
   05169 Epstein-Barr virus infection
    107509253
   05165 Human papillomavirus infection
    107509253
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ray04052]
    107509253
Cytokines and growth factors [BR:ray04052]
 Cytokines
  Interferons
   107509253
SSDB
Motif
Pfam: Interferon PARG_cat
Other DBs
NCBI-GeneID: 107509253
NCBI-ProteinID: XP_015997141
LinkDB
Position
Unknown
AA seq 274 aa
MALPCSFLMAVVVLSCHSICSLGCDLPLTHSLVDRRALMLLGQMRRISPFSCLKDREDFG
FPQGVLHGNQFQEAQAIAVAHEVTRQTFLLFCTEASSAAWDETLRSRFCTGLHQQLIDLE
ACRTREVGAEETPLLDEDSTRAVRSYFQRLFLYLQEKKHSPCAWEIIRAEIMRSYSLSKL
FREELQRKQRQQRTSRNGKKMKVSSRLRTVKEYREVYGVDFNRQALGGGKIPMGSTESEV
SPDYSYSDGEESHVDSPSTNFSHRDVANSSVPGP
NT seq 825 nt   +upstreamnt  +downstreamnt
atggccctgccctgttccttcctgatggccgtggtggtgctcagctgccactccatctgc
tctctgggttgtgacctgcctctgacccacagcctggtcgacaggagggcgttgatgctt
ctgggacaaatgaggagaatctctcctttctcctgcctcaaggacagagaagactttgga
ttcccccagggggtgcttcatggcaaccagttccaggaggctcaagccatcgctgttgcc
cacgaggtgacccggcagaccttcctcctcttctgcacagaggcctcatccgcagcttgg
gatgagaccctgcgaagcagattctgcactggactccatcagcagctgatcgacctggaa
gcctgtcggacgcgggaggtgggggcggaggagactcccctgctggatgaggactccaca
cgggctgtgaggagttacttccagagactcttcctctatctgcaggagaagaaacacagc
ccttgtgcctgggagattatcagagcagagatcatgaggtcctactctttatcaaaactt
tttagagaagagctacaaagaaaacagaggcaacagcgcacatctagaaacgggaagaag
atgaaagtcagcagcagattgaggaccgtgaaagaatacagagaggtttatggtgtggac
ttcaacaggcaggccctagggggtggaaagattccaatgggcagcacggagtcagaggtt
tctccagattattcctattcagacggggaggagagccatgtggattccccgagcacaaac
ttctcccaccgagatgtggccaatagcagtgtccccgggccgtga

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107510611
Entry
107510611         CDS       T06036                                 

Definition
(RefSeq) interferon omega-1-like
  KO
K05414  interferon alpha
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04060  Cytokine-cytokine receptor interaction
ray04151  PI3K-Akt signaling pathway
ray04217  Necroptosis
ray04620  Toll-like receptor signaling pathway
ray04621  NOD-like receptor signaling pathway
ray04622  RIG-I-like receptor signaling pathway
ray04623  Cytosolic DNA-sensing pathway
ray04630  JAK-STAT signaling pathway
ray04650  Natural killer cell mediated cytotoxicity
ray05152  Tuberculosis
ray05160  Hepatitis C
ray05161  Hepatitis B
ray05162  Measles
ray05163  Human cytomegalovirus infection
ray05164  Influenza A
ray05165  Human papillomavirus infection
ray05167  Kaposi sarcoma-associated herpesvirus infection
ray05168  Herpes simplex virus 1 infection
ray05169  Epstein-Barr virus infection
ray05170  Human immunodeficiency virus 1 infection
ray05171  Coronavirus disease - COVID-19
ray05200  Pathways in cancer
ray05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    107510611
   04151 PI3K-Akt signaling pathway
    107510611
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    107510611
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    107510611
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    107510611
   04621 NOD-like receptor signaling pathway
    107510611
   04622 RIG-I-like receptor signaling pathway
    107510611
   04623 Cytosolic DNA-sensing pathway
    107510611
   04650 Natural killer cell mediated cytotoxicity
    107510611
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107510611
  09163 Immune disease
   05320 Autoimmune thyroid disease
    107510611
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    107510611
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    107510611
   05161 Hepatitis B
    107510611
   05160 Hepatitis C
    107510611
   05171 Coronavirus disease - COVID-19
    107510611
   05164 Influenza A
    107510611
   05162 Measles
    107510611
   05168 Herpes simplex virus 1 infection
    107510611
   05163 Human cytomegalovirus infection
    107510611
   05167 Kaposi sarcoma-associated herpesvirus infection
    107510611
   05169 Epstein-Barr virus infection
    107510611
   05165 Human papillomavirus infection
    107510611
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ray04052]
    107510611
Cytokines and growth factors [BR:ray04052]
 Cytokines
  Interferons
   107510611
SSDB
Motif
Pfam: Interferon RNase_P_p30 SEO_C
Other DBs
NCBI-GeneID: 107510611
NCBI-ProteinID: XP_015999790
LinkDB
Position
Unknown
AA seq 171 aa
MAQRCSWLAAGAMLSSILVCSLAGDVPWMHSLENRKIVSLLRELEAMPSHLCLNDRTDFK
FPWERGNSAQVQKTRRTCFHHLMLQQIFHLLNAADSHAAWNRTLLSQLLSRLHHSLEQLD
RTNEGNLLCSDLDILVWKYFQGIHHYLKQKKYGTCAWEVVRVEITARLILM
NT seq 516 nt   +upstreamnt  +downstreamnt
atggcccagcgctgttcgtggctggcggccggagcgatgctcagctccatcctggtttgc
tctcttgctggagacgtgccttggatgcacagcctagaaaacaggaaaatcgtcagtctt
ttgagagagctggaagctatgccctctcacttgtgcctgaatgacagaaccgacttcaaa
tttccttgggaaagagggaatagcgcccaagtccagaagacacgacgcacctgtttccac
catctcatgctccagcagatcttccacctgttgaacgcggcggacagccatgctgcttgg
aaccgcaccctcctctctcaactactctctaggcttcatcacagcctagagcagctggac
cggacaaacgaaggaaatctgctttgctccgatttggacattcttgtctggaaatacttc
caaggaatccatcactatctgaaacaaaagaagtacggcacctgtgcttgggaagttgtc
agagtcgagatcacagcgcgccttattctcatgtga

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107511342
Entry
107511342         CDS       T06036                                 

Definition
(RefSeq) interferon alpha-1-like
  KO
K05414  interferon alpha
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04060  Cytokine-cytokine receptor interaction
ray04151  PI3K-Akt signaling pathway
ray04217  Necroptosis
ray04620  Toll-like receptor signaling pathway
ray04621  NOD-like receptor signaling pathway
ray04622  RIG-I-like receptor signaling pathway
ray04623  Cytosolic DNA-sensing pathway
ray04630  JAK-STAT signaling pathway
ray04650  Natural killer cell mediated cytotoxicity
ray05152  Tuberculosis
ray05160  Hepatitis C
ray05161  Hepatitis B
ray05162  Measles
ray05163  Human cytomegalovirus infection
ray05164  Influenza A
ray05165  Human papillomavirus infection
ray05167  Kaposi sarcoma-associated herpesvirus infection
ray05168  Herpes simplex virus 1 infection
ray05169  Epstein-Barr virus infection
ray05170  Human immunodeficiency virus 1 infection
ray05171  Coronavirus disease - COVID-19
ray05200  Pathways in cancer
ray05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    107511342
   04151 PI3K-Akt signaling pathway
    107511342
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    107511342
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    107511342
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    107511342
   04621 NOD-like receptor signaling pathway
    107511342
   04622 RIG-I-like receptor signaling pathway
    107511342
   04623 Cytosolic DNA-sensing pathway
    107511342
   04650 Natural killer cell mediated cytotoxicity
    107511342
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107511342
  09163 Immune disease
   05320 Autoimmune thyroid disease
    107511342
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    107511342
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    107511342
   05161 Hepatitis B
    107511342
   05160 Hepatitis C
    107511342
   05171 Coronavirus disease - COVID-19
    107511342
   05164 Influenza A
    107511342
   05162 Measles
    107511342
   05168 Herpes simplex virus 1 infection
    107511342
   05163 Human cytomegalovirus infection
    107511342
   05167 Kaposi sarcoma-associated herpesvirus infection
    107511342
   05169 Epstein-Barr virus infection
    107511342
   05165 Human papillomavirus infection
    107511342
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ray04052]
    107511342
Cytokines and growth factors [BR:ray04052]
 Cytokines
  Interferons
   107511342
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 107511342
NCBI-ProteinID: XP_016001139
LinkDB
Position
Unknown
AA seq 188 aa
MALPCSFLMAVVVLSFHSICSLGCLPQTHSLVNRRALMLLGQMRRISPFSCLKDREDFGF
PQGVFRGNQFQEAQAIAVAHEVTRQTFLLFCTEASSAAWDETPLGRFCTGLYQQLNHLEA
CQTREVGVEETPLLDEDSTLAVRRYFQRITLYLQEKKHSPCAWEIIRAEFMRSYSLSTHL
KETSRSKD
NT seq 567 nt   +upstreamnt  +downstreamnt
atggccctaccctgttcctttctaatggccgtggtggtgctcagtttccactccatctgc
tctctgggctgcctgcctcagacccacagcctggtcaacaggagggcattgatgctcctg
ggacaaatgaggagaatctcccctttctcctgcctcaaggacagagaagactttggattc
ccccagggggtgtttcgtggcaaccagttccaagaggctcaagccatcgctgttgcccac
gaggtgacccggcagaccttcctcctcttctgcacagaggcctcatccgcagcttgggat
gagaccccgctaggcagattctgcactggactctatcagcagctgaaccacctggaagcc
tgtcagacgcgggaggtgggggtggaggagactcccctgctggatgaggactccacactg
gctgtgaggagatacttccagagaatcaccctctatctgcaggagaagaaacacagccct
tgtgcctgggagattatcagagcagagttcatgaggtcctactctttatcaacacacttg
aaggaaacatcaaggagtaaagattga

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107511568
Entry
107511568         CDS       T06036                                 

Definition
(RefSeq) interferon alpha-1-like
  KO
K05414  interferon alpha
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04060  Cytokine-cytokine receptor interaction
ray04151  PI3K-Akt signaling pathway
ray04217  Necroptosis
ray04620  Toll-like receptor signaling pathway
ray04621  NOD-like receptor signaling pathway
ray04622  RIG-I-like receptor signaling pathway
ray04623  Cytosolic DNA-sensing pathway
ray04630  JAK-STAT signaling pathway
ray04650  Natural killer cell mediated cytotoxicity
ray05152  Tuberculosis
ray05160  Hepatitis C
ray05161  Hepatitis B
ray05162  Measles
ray05163  Human cytomegalovirus infection
ray05164  Influenza A
ray05165  Human papillomavirus infection
ray05167  Kaposi sarcoma-associated herpesvirus infection
ray05168  Herpes simplex virus 1 infection
ray05169  Epstein-Barr virus infection
ray05170  Human immunodeficiency virus 1 infection
ray05171  Coronavirus disease - COVID-19
ray05200  Pathways in cancer
ray05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    107511568
   04151 PI3K-Akt signaling pathway
    107511568
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    107511568
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    107511568
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    107511568
   04621 NOD-like receptor signaling pathway
    107511568
   04622 RIG-I-like receptor signaling pathway
    107511568
   04623 Cytosolic DNA-sensing pathway
    107511568
   04650 Natural killer cell mediated cytotoxicity
    107511568
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107511568
  09163 Immune disease
   05320 Autoimmune thyroid disease
    107511568
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    107511568
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    107511568
   05161 Hepatitis B
    107511568
   05160 Hepatitis C
    107511568
   05171 Coronavirus disease - COVID-19
    107511568
   05164 Influenza A
    107511568
   05162 Measles
    107511568
   05168 Herpes simplex virus 1 infection
    107511568
   05163 Human cytomegalovirus infection
    107511568
   05167 Kaposi sarcoma-associated herpesvirus infection
    107511568
   05169 Epstein-Barr virus infection
    107511568
   05165 Human papillomavirus infection
    107511568
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ray04052]
    107511568
Cytokines and growth factors [BR:ray04052]
 Cytokines
  Interferons
   107511568
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 107511568
NCBI-ProteinID: XP_016001523
LinkDB
Position
Unknown
AA seq 189 aa
MALPCSFLMAVVVLSCHSICSLGCDLPLTHSLVDRRALMLLGQMRRISPFSCLKDREDFG
FPQGVLHGNQLQEAQAIAVAHEVTRQTFLLFCTEASSAAWDETLRSRFCTGLHQQLNDLE
ACRTREVGAEETPLLDEDSTRAVRSYFQRLFLYLQEKKHSPCAWEIIRAEIMSSYSLSTH
LKETSRSKD
NT seq 570 nt   +upstreamnt  +downstreamnt
atggccctgccctgttccttcctgatggccgtggtggtgctcagctgccactccatctgc
tctctgggttgtgacctgcctctgacccacagcctggtcgacaggagggcgttgatgctt
ctgggacaaatgaggagaatctctcctttctcctgcctcaaggacagagaagactttgga
ttcccccagggggtgcttcatggcaaccagctccaggaggctcaagccatcgctgttgcc
cacgaggtgacccggcagaccttcctcctcttctgcacagaggcctcatccgcagcttgg
gatgagaccctgcgaagcagattctgcactggactccatcagcagctgaacgacctggaa
gcctgtcggacgcgggaggtgggggcggaggagactcccctgctggatgaggactccaca
cgggctgtgaggagttacttccagagactcttcctctatctgcaggagaagaaacacagc
ccttgtgcctgggagattatcagagcagagatcatgagctcctactctttatcaacacac
ttgaaggaaacatcaaggagtaaggattga

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107518584
Entry
107518584         CDS       T06036                                 

Definition
(RefSeq) interferon alpha-1-like
  KO
K05414  interferon alpha
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04060  Cytokine-cytokine receptor interaction
ray04151  PI3K-Akt signaling pathway
ray04217  Necroptosis
ray04620  Toll-like receptor signaling pathway
ray04621  NOD-like receptor signaling pathway
ray04622  RIG-I-like receptor signaling pathway
ray04623  Cytosolic DNA-sensing pathway
ray04630  JAK-STAT signaling pathway
ray04650  Natural killer cell mediated cytotoxicity
ray05152  Tuberculosis
ray05160  Hepatitis C
ray05161  Hepatitis B
ray05162  Measles
ray05163  Human cytomegalovirus infection
ray05164  Influenza A
ray05165  Human papillomavirus infection
ray05167  Kaposi sarcoma-associated herpesvirus infection
ray05168  Herpes simplex virus 1 infection
ray05169  Epstein-Barr virus infection
ray05170  Human immunodeficiency virus 1 infection
ray05171  Coronavirus disease - COVID-19
ray05200  Pathways in cancer
ray05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    107518584
   04151 PI3K-Akt signaling pathway
    107518584
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    107518584
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    107518584
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    107518584
   04621 NOD-like receptor signaling pathway
    107518584
   04622 RIG-I-like receptor signaling pathway
    107518584
   04623 Cytosolic DNA-sensing pathway
    107518584
   04650 Natural killer cell mediated cytotoxicity
    107518584
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107518584
  09163 Immune disease
   05320 Autoimmune thyroid disease
    107518584
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    107518584
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    107518584
   05161 Hepatitis B
    107518584
   05160 Hepatitis C
    107518584
   05171 Coronavirus disease - COVID-19
    107518584
   05164 Influenza A
    107518584
   05162 Measles
    107518584
   05168 Herpes simplex virus 1 infection
    107518584
   05163 Human cytomegalovirus infection
    107518584
   05167 Kaposi sarcoma-associated herpesvirus infection
    107518584
   05169 Epstein-Barr virus infection
    107518584
   05165 Human papillomavirus infection
    107518584
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ray04052]
    107518584
Cytokines and growth factors [BR:ray04052]
 Cytokines
  Interferons
   107518584
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 107518584
NCBI-ProteinID: XP_016015898
LinkDB
Position
Unknown
AA seq 189 aa
MALPCSFLMAVVVLSCHSICSLGCDLPLTHSLVDRRALMLLGQMRRISPFSCLKDREDFG
FPQGVLHGNQLQEAQAIAVAHEVTRQTFLLFCTEASSAAWDETLRSRFCTGLHQQLIHLE
ACQTREVGAEETPLLDEDSTLAVRSYFQRLFLYLQEKKHSPCAWEIIRAEIMSSYSLSKL
FREELQRKQ
NT seq 569 nt   +upstreamnt  +downstreamnt
atggccctgccctgttccttcctgatggccgtcgtggtgctcagctgccactccatctgc
tctctgggttgtgacctgcctctgacccacagcctggtcgacaggagggcgttgatgctt
ctgggacaaatgaggagaatctctcctttctcctgcctcaaggacagagaagactttgga
ttcccccagggggtgcttcatggcaaccagctccaggaggctcaagccatcgctgttgcc
cacgaggtgacccggcagaccttcctcctcttctgcacagaggcctcatccgcagcttgg
gatgagaccctgcgaagcagattctgcactggactccatcagcagctgatccacctggaa
gcctgtcagacgcgggaggtgggggcggaggagactcccctgctggatgaggactccaca
ctggctgtgaggagttacttccagagactcttcctctatctgcaggagaagaaacacagc
ccttgtgcctgggagattatcagagcagagatcatgagctcctactctttatcaaaactt
tttagagaagagctacaaagaaaacagag

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107518586
Entry
107518586         CDS       T06036                                 

Definition
(RefSeq) interferon alpha-1-like
  KO
K05414  interferon alpha
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04060  Cytokine-cytokine receptor interaction
ray04151  PI3K-Akt signaling pathway
ray04217  Necroptosis
ray04620  Toll-like receptor signaling pathway
ray04621  NOD-like receptor signaling pathway
ray04622  RIG-I-like receptor signaling pathway
ray04623  Cytosolic DNA-sensing pathway
ray04630  JAK-STAT signaling pathway
ray04650  Natural killer cell mediated cytotoxicity
ray05152  Tuberculosis
ray05160  Hepatitis C
ray05161  Hepatitis B
ray05162  Measles
ray05163  Human cytomegalovirus infection
ray05164  Influenza A
ray05165  Human papillomavirus infection
ray05167  Kaposi sarcoma-associated herpesvirus infection
ray05168  Herpes simplex virus 1 infection
ray05169  Epstein-Barr virus infection
ray05170  Human immunodeficiency virus 1 infection
ray05171  Coronavirus disease - COVID-19
ray05200  Pathways in cancer
ray05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    107518586
   04151 PI3K-Akt signaling pathway
    107518586
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    107518586
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    107518586
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    107518586
   04621 NOD-like receptor signaling pathway
    107518586
   04622 RIG-I-like receptor signaling pathway
    107518586
   04623 Cytosolic DNA-sensing pathway
    107518586
   04650 Natural killer cell mediated cytotoxicity
    107518586
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107518586
  09163 Immune disease
   05320 Autoimmune thyroid disease
    107518586
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    107518586
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    107518586
   05161 Hepatitis B
    107518586
   05160 Hepatitis C
    107518586
   05171 Coronavirus disease - COVID-19
    107518586
   05164 Influenza A
    107518586
   05162 Measles
    107518586
   05168 Herpes simplex virus 1 infection
    107518586
   05163 Human cytomegalovirus infection
    107518586
   05167 Kaposi sarcoma-associated herpesvirus infection
    107518586
   05169 Epstein-Barr virus infection
    107518586
   05165 Human papillomavirus infection
    107518586
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ray04052]
    107518586
Cytokines and growth factors [BR:ray04052]
 Cytokines
  Interferons
   107518586
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 107518586
NCBI-ProteinID: XP_016015899
LinkDB
Position
Unknown
AA seq 188 aa
MALHCSFLMAVVVLSFHSICSLGCLPQTHSLVNRRALMLLGQMRRISPFSCLKDREDFGF
PQGVFRGNQFQEAQAIAVAHEVTRQTFLLFCTDASSAAWDETPLGRFCTGLYQQLNHLEA
CQTREVGVEETPLLDEDSALAVRRYFQRITLYLQEKKHSPCAWEIIRAEFMRSYSLSTHL
KETSRSKD
NT seq 567 nt   +upstreamnt  +downstreamnt
atggccctacactgttcctttctaatggccgtggtggtgctcagtttccactccatctgc
tctctgggctgcctgcctcagacccacagcctggtcaacaggagggcattgatgctcctg
ggacaaatgaggagaatctcccctttctcctgcctcaaggacagagaagactttggattc
ccccagggggtgtttcgtggcaaccagttccaagaggctcaagccatcgctgttgcccac
gaggtgacccggcagaccttcctcctcttctgcacagatgcctcatccgcagcttgggat
gagaccccgctaggcagattctgcactggactctatcagcagctgaaccacctggaagcc
tgtcagacgcgggaggtgggggtggaggagactcccctgctggatgaggactccgcactg
gctgtgaggagatacttccagagaatcaccctctatctgcaggagaagaaacacagccct
tgtgcctgggagattatcagagcagagttcatgaggtcctactctttatcaacacacttg
aaggaaacatcaaggagtaaagattga

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107518587
Entry
107518587         CDS       T06036                                 

Definition
(RefSeq) interferon alpha-4-like
  KO
K05414  interferon alpha
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04060  Cytokine-cytokine receptor interaction
ray04151  PI3K-Akt signaling pathway
ray04217  Necroptosis
ray04620  Toll-like receptor signaling pathway
ray04621  NOD-like receptor signaling pathway
ray04622  RIG-I-like receptor signaling pathway
ray04623  Cytosolic DNA-sensing pathway
ray04630  JAK-STAT signaling pathway
ray04650  Natural killer cell mediated cytotoxicity
ray05152  Tuberculosis
ray05160  Hepatitis C
ray05161  Hepatitis B
ray05162  Measles
ray05163  Human cytomegalovirus infection
ray05164  Influenza A
ray05165  Human papillomavirus infection
ray05167  Kaposi sarcoma-associated herpesvirus infection
ray05168  Herpes simplex virus 1 infection
ray05169  Epstein-Barr virus infection
ray05170  Human immunodeficiency virus 1 infection
ray05171  Coronavirus disease - COVID-19
ray05200  Pathways in cancer
ray05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    107518587
   04151 PI3K-Akt signaling pathway
    107518587
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    107518587
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    107518587
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    107518587
   04621 NOD-like receptor signaling pathway
    107518587
   04622 RIG-I-like receptor signaling pathway
    107518587
   04623 Cytosolic DNA-sensing pathway
    107518587
   04650 Natural killer cell mediated cytotoxicity
    107518587
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107518587
  09163 Immune disease
   05320 Autoimmune thyroid disease
    107518587
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    107518587
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    107518587
   05161 Hepatitis B
    107518587
   05160 Hepatitis C
    107518587
   05171 Coronavirus disease - COVID-19
    107518587
   05164 Influenza A
    107518587
   05162 Measles
    107518587
   05168 Herpes simplex virus 1 infection
    107518587
   05163 Human cytomegalovirus infection
    107518587
   05167 Kaposi sarcoma-associated herpesvirus infection
    107518587
   05169 Epstein-Barr virus infection
    107518587
   05165 Human papillomavirus infection
    107518587
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ray04052]
    107518587
Cytokines and growth factors [BR:ray04052]
 Cytokines
  Interferons
   107518587
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 107518587
NCBI-ProteinID: XP_016015901
LinkDB
Position
Unknown
AA seq 189 aa
MALPFSFLVAVVVLSCYSICSLGCDLPQTHSLVNKRALMLLGQMRRISPFSCLKDREDFG
FPQGVFRGNQFQQAQAITVVHEVTQQTFLLFCTEASSTAWDETLLGRFCTGLYQQLNHLE
ACQTREVGVEETPLLDEDSTLAVRRYFQRITLYLQEKKHSPCAWEIVRAEIMRSYALSTH
LKERSRSKD
NT seq 570 nt   +upstreamnt  +downstreamnt
atggccctgcctttttccttcctggtggctgtggtggtgctcagttgctactccatctgc
tctctgggctgtgacctgcctcagacccacagcctggtcaacaagagggcgctgatgctc
ctgggacaaatgaggagaatctcccctttctcctgcctcaaggacagagaagactttgga
ttcccccagggggtgtttcgtggcaaccagttccagcaggctcaagccatcactgtcgtc
catgaggtgacccaacagaccttcctcctcttctgcacagaggcctcgtccacagcttgg
gatgagaccctgctaggcagattctgcactggactctatcagcagctgaaccacctggaa
gcctgtcagacgcgggaggtgggggtggaggagactcccctgctggatgaggactccaca
ctggctgtgaggagatacttccagagaatcaccctctatctgcaggagaagaaacacagc
ccttgtgcctgggagattgtcagagccgagatcatgaggtcctatgctttatcaacacac
ttgaaggaaagatcaaggagtaaggattga

DBGET integrated database retrieval system