KEGG   Rousettus aegyptiacus (Egyptian rousette): 107506789
Entry
107506789         CDS       T06036                                 

Definition
(RefSeq) cyclin-dependent kinase inhibitor 2A-like
  KO
K06621  cyclin-dependent kinase inhibitor 2A
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray01522  Endocrine resistance
ray01524  Platinum drug resistance
ray04110  Cell cycle
ray04115  p53 signaling pathway
ray04218  Cellular senescence
ray04934  Cushing syndrome
ray05163  Human cytomegalovirus infection
ray05166  Human T-cell leukemia virus 1 infection
ray05200  Pathways in cancer
ray05203  Viral carcinogenesis
ray05206  MicroRNAs in cancer
ray05212  Pancreatic cancer
ray05214  Glioma
ray05218  Melanoma
ray05219  Bladder cancer
ray05220  Chronic myeloid leukemia
ray05223  Non-small cell lung cancer
ray05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:ray00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    107506789
   04115 p53 signaling pathway
    107506789
   04218 Cellular senescence
    107506789
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107506789
   05206 MicroRNAs in cancer
    107506789
   05203 Viral carcinogenesis
    107506789
  09162 Cancer: specific types
   05212 Pancreatic cancer
    107506789
   05225 Hepatocellular carcinoma
    107506789
   05214 Glioma
    107506789
   05220 Chronic myeloid leukemia
    107506789
   05218 Melanoma
    107506789
   05219 Bladder cancer
    107506789
   05223 Non-small cell lung cancer
    107506789
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    107506789
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    107506789
   05163 Human cytomegalovirus infection
    107506789
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    107506789
   01522 Endocrine resistance
    107506789
SSDB
Motif
Pfam: Ank_5 Ank_4 Ank_2 Ank DUF2384 Arm-DNA-bind_3
Other DBs
NCBI-GeneID: 107506789
NCBI-ProteinID: XP_015993124
LinkDB
Position
Unknown
AA seq 144 aa
MEPSADWLSAAAARGRADEVRALLEEGAPPNAPNSHGRSPIQVMMMGSARVAELLLLHGA
DPNCADPVTLTRPVHDAAREGFLDTLVALHRAGARLDVRDAWGRLPVDLAEERGHREVSE
YLRAASGGTEGGSHAAEGPTDTRN
NT seq 435 nt   +upstreamnt  +downstreamnt
atggagccctcggccgactggttgtctgccgcggccgcccggggccgcgcggatgaggtg
cgggcgctgctcgaggagggggcacctcccaatgcgcccaacagtcacggtcggagcccg
attcaggtcatgatgatgggcagcgcccgcgtggcggagctgctgctgctgcacggcgcg
gaccccaactgcgccgacccggtcactctcacccgaccggtgcacgacgccgcccgggag
ggcttcctggacacgctcgtggcgctgcaccgagccggggcgcggctggacgtgcgcgat
gcctggggccgcctgcccgtagacctggctgaagagaggggccaccgcgaagtctccgag
tacctgcgcgcggcctcaggaggcactgaaggcggtagccacgctgcagaaggtcccaca
gatacccgcaactga

DBGET integrated database retrieval system