KEGG   Rousettus aegyptiacus (Egyptian rousette): 107507013
Entry
107507013         CDS       T06036                                 

Gene name
DVL3
Definition
(RefSeq) segment polarity protein dishevelled homolog DVL-3 isoform X1
  KO
K02353  segment polarity protein dishevelled
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04150  mTOR signaling pathway
ray04310  Wnt signaling pathway
ray04330  Notch signaling pathway
ray04390  Hippo signaling pathway
ray04550  Signaling pathways regulating pluripotency of stem cells
ray04916  Melanogenesis
ray04934  Cushing syndrome
ray05010  Alzheimer disease
ray05022  Pathways of neurodegeneration - multiple diseases
ray05165  Human papillomavirus infection
ray05200  Pathways in cancer
ray05217  Basal cell carcinoma
ray05224  Breast cancer
ray05225  Hepatocellular carcinoma
ray05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    107507013 (DVL3)
   04330 Notch signaling pathway
    107507013 (DVL3)
   04390 Hippo signaling pathway
    107507013 (DVL3)
   04150 mTOR signaling pathway
    107507013 (DVL3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    107507013 (DVL3)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    107507013 (DVL3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107507013 (DVL3)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    107507013 (DVL3)
   05226 Gastric cancer
    107507013 (DVL3)
   05217 Basal cell carcinoma
    107507013 (DVL3)
   05224 Breast cancer
    107507013 (DVL3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    107507013 (DVL3)
   05022 Pathways of neurodegeneration - multiple diseases
    107507013 (DVL3)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    107507013 (DVL3)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    107507013 (DVL3)
SSDB
Motif
Pfam: Dsh_C Dishevelled DIX DEP PDZ PDZ_6 Shufflon_N
Other DBs
NCBI-GeneID: 107507013
NCBI-ProteinID: XP_015993468
LinkDB
Position
Unknown
AA seq 754 aa
MGETKIIYHLDGQETPYLVKLPLPAERVTLADFKGVLQRPSYKFFFKSMDDDFGVVKEEI
SDDNAKLPCFNGRVVSWLVSAEGSHPEPAPFCADNPSELPPPMERTGGIGDSRPPSFHPH
AGGGSQENLDNDTETDSLVSAQRERPRRRDGPEHTARLNGTAKGERRRDPGGYDSSSTLM
SSELETTSFFDSDEDDSTSRFSSSTEQSSASRLMRRHKRRRRKQKVSRIERSSSFSSITD
STMSLNIITVTLNMEKYNFLGISIVGQSNERGDGGIYIGSIMKGGAVAADGRIEPGDMLL
QVNEINFENMSNDDAVRVLREIVHKPGYGWDGHYRRGGRHFWLSGKGFGLASTHPALTRD
TLAFRPITLTVAKCWDPSPRGCFTLPRSEPIRPIDPAAWVSHTAAMTGTFPAYGMSPSLS
TITSTSSSITSSIPDTERLDDFHLSIHSDMAAIVKAMASPESGLEVRDRMWLKITIPNAF
IGSDVVDWLYHNVEGFTDRREARKYASNLLKAGFIRHTVNKITFSEQCYYIFGDLCGNMA
NLSLHDHDGSSGASDQDTLAPLPHPGAAPWPMAFPYQYPPPPHPYNPHPGFPELGYSYGG
GSASSQHSEGSRSSGSNRSGSDRRKEKDPKAGDSKSGGSGSESDHTTRSSLRGPRERAPS
ERSGPTASEHSHRSHHSLASSLRSHHTHPSYGPPGVPPLYGPPMLMMPPPPAAMGPPGAP
PGRDLASVPPELTASRQSFRMAMGNPSEFFVDVM
NT seq 2265 nt   +upstreamnt  +downstreamnt
atgggagagaccaagatcatctaccacctggacgggcaggagacgccgtacctggtgaag
ctgcccctgcccgccgagcgcgtcaccttggcggactttaagggcgttctgcagcgaccc
agctataagttcttcttcaagtctatggacgacgatttcggagtggtgaaggaagagatc
tcagatgacaatgcaaagctgccctgcttcaatggccgggtggtgtcctggctggtgtca
gctgagggctcacacccagagccagctcccttttgtgctgataacccatcagagctgcca
ccacccatggagcgcacaggaggcattggggactcccggcccccatccttccaccctcat
gctggtgggggcagccaggagaacctggacaatgatacagagacggactcattggtgtct
gcccagcgggagcggccacgcaggagggacggcccagagcacacagcccggctaaatgga
actgcaaagggggaacgacggcgagatccagggggttatgacagctcatccaccctcatg
agcagtgaattggagaccaccagcttctttgattcagatgaagatgactctaccagcagg
ttcagcagctccacagagcagagcagcgcctcacgcctgatgagaagacacaagcggcgg
cggcggaagcagaaggtttcccggattgagcggtcctcgtccttcagcagcatcacggac
tccaccatgtcactcaacatcatcacggtcactctcaacatggaaaagtataacttcttg
ggcatctccattgtgggccaaagcaacgagcgtggtgacggaggcatctacattggctct
atcatgaagggtggggctgtggctgctgatggacgcatcgagccaggagatatgctgtta
caggtaaacgagatcaactttgagaacatgagtaatgatgacgcggtccgggtactgcgg
gagattgtgcacaaaccagggtatggatgggatgggcattacagaagaggaggcagacat
ttctggctctcaggcaaggggtttggtctggcctccacacatcctgccctcactagggac
acccttgctttcaggcccatcaccctgactgtagccaagtgctgggacccaagcccacgt
ggttgcttcacactgcccaggagcgagcccatcaggcccattgaccctgcggcctgggtc
tctcacactgcagccatgactggcaccttccctgcctacggcatgagcccctccctgagc
accatcacctccaccagctcctccatcaccagctccatccctgacacagagcggctagat
gatttccacctgtccatccacagtgacatggctgccattgtgaaagccatggcctcccct
gaatccgggttggaggtccgagaccgcatgtggctcaagatcaccatccccaatgctttc
atcggctcggatgtggtggactggctgtaccacaacgtggaaggcttcactgaccggcga
gaggcccgcaagtacgccagcaacctgctgaaagctggcttcattcgccacactgtgaac
aagatcactttctccgagcagtgctactacatcttcggcgacctttgcggcaacatggcc
aacctgtctctccatgatcatgatggctctagtggtgcctctgaccaggacacgctggcc
cctttgccgcaccccggggccgccccttggcccatggctttcccttaccagtacccacca
cccccgcacccttacaacccgcatccaggctttcctgagctggggtacagctacggcggg
ggcagcgctagcagtcagcacagtgaaggcagccggagcagtggctccaaccgtagtggc
agcgaccggcggaaagagaaggacccgaaggctggggactcaaagtccggaggcagtggc
agcgagtcggaccacacaacccgcagcagccttcgggggccgcgagagcgggcgcccagc
gagcgctcagggcctactgccagcgagcatagccaccgtagccaccactcgctggccagc
agcctgcgcagccaccacacgcacccaagctacggtccccctggtgtgccccctctctac
ggccctcctatgctgatgatgcccccaccgcctgcggccatgggacccccaggagcccct
cctggccgtgacctggcctcggtgccccctgaactgaccgccagcagacagtccttccgc
atggccatgggaaaccccagtgagttctttgtggatgtgatgtga

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107509513
Entry
107509513         CDS       T06036                                 

Gene name
DVL2
Definition
(RefSeq) segment polarity protein dishevelled homolog DVL-2 isoform X1
  KO
K02353  segment polarity protein dishevelled
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04150  mTOR signaling pathway
ray04310  Wnt signaling pathway
ray04330  Notch signaling pathway
ray04390  Hippo signaling pathway
ray04550  Signaling pathways regulating pluripotency of stem cells
ray04916  Melanogenesis
ray04934  Cushing syndrome
ray05010  Alzheimer disease
ray05022  Pathways of neurodegeneration - multiple diseases
ray05165  Human papillomavirus infection
ray05200  Pathways in cancer
ray05217  Basal cell carcinoma
ray05224  Breast cancer
ray05225  Hepatocellular carcinoma
ray05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    107509513 (DVL2)
   04330 Notch signaling pathway
    107509513 (DVL2)
   04390 Hippo signaling pathway
    107509513 (DVL2)
   04150 mTOR signaling pathway
    107509513 (DVL2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    107509513 (DVL2)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    107509513 (DVL2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107509513 (DVL2)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    107509513 (DVL2)
   05226 Gastric cancer
    107509513 (DVL2)
   05217 Basal cell carcinoma
    107509513 (DVL2)
   05224 Breast cancer
    107509513 (DVL2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    107509513 (DVL2)
   05022 Pathways of neurodegeneration - multiple diseases
    107509513 (DVL2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    107509513 (DVL2)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    107509513 (DVL2)
SSDB
Motif
Pfam: Dsh_C Dishevelled DIX PDZ DEP PDZ_6 Shufflon_N
Other DBs
NCBI-GeneID: 107509513
NCBI-ProteinID: XP_015997580
LinkDB
Position
Unknown
AA seq 736 aa
MAGSGAGVSGVGETKVIYHLDEEETPYLVKIPVPAERITLGDFKSVLQRPAGAKYFFKSM
DQDFGVVKEEISDDNARLPCFNGRVVSWLVSSDNSQPEMTPSAQEPRTELAPPPPPLPPL
PPERTSGIGDSRPPSFHPNVSSSRENLEPETETESVVSLRRERPRRRDSSEHGAGGHRPN
GPSRLERHLAGYESSSTLMTSELESTSLGDSDEDDTMSRFSSSTEQSSASRLLKRHRRRR
KQRPPRLERTSSFSSVTDSTMSLNIITVTLNMEKYNFLGISIVGQSNERGDGGIYIGSIM
KGGAVAADGRIEPGDMLLQVNDMNFENMSNDDAVRVLRDIVHKPGPIVLTVAKCWDPSPQ
AYFTLPRNEPIQPIDPAAWVSHSAALTGTFPAYPGSSSMSTITSGSSLPDGCEGRGLSIH
TDMASVTKAMAAPESGLEVRDRMWLKITIPNAFLGSDVVDWLYHHVEGFPERREARKYAS
GLLKAGLIRHTVNKITFSEQCYYVFGDLSGGCENYLVNLSLNDNDGSSGASDQDTLAPLP
GTTPWPLLPTFSYQYPAPHPYSPQPPPYHELSSYTYGGGSASSQHSEGSRSSGSARSDGG
AGRTGRPEERAPESKSGSGSESEPSSRGGSLRRGGDPSGTGDGGPPLSRSSSGGTPSHQA
HPGLHPYGPPPGMALPYNPMMVVMMPPPPPAAPPVVQPPGAPPIRDLGSVPPELTASRQS
FHMAMGNPSEFFVDVM
NT seq 2211 nt   +upstreamnt  +downstreamnt
atggcgggcagcggcgcgggggttagtggtgtcggagagacgaaggtgatttaccatttg
gatgaagaagagactccctacctggtgaagatccccgtccctgccgagcgcatcaccctt
ggcgattttaagagcgtactgcagcgacccgcgggcgctaagtactttttcaagtctatg
gatcaggatttcggggtggtgaaggaagaaatttcagatgacaatgcccgccttccctgc
ttcaacggaagggtggtttcctggctcgtgtcatcggataactcccagcctgagatgact
ccctcagctcaggaacctcggacagaactggcacctccacccccaccattaccccctttg
ccaccagagaggaccagtggcattggggattctagacctccatccttccaccctaatgtt
tcgagcagccgggaaaatctggagcctgagacagaaacagagtcagtagtgtctctgagg
cgggagcggcctcggagaagagacagcagtgagcatggcgctgggggccacaggcccaac
ggcccctctaggctggagcgccacctggctgggtacgagagctcctcaacccttatgact
agcgagctggagagcactagcctaggggactcagatgaggatgataccatgagcaggttc
agcagctccacggagcagagcagtgcctcccgcctcctcaagcgtcaccggcggcgaagg
aaacagcggccaccccgtctggagaggacctcatccttcagcagtgtcactgattccaca
atgtctctcaacatcatcacagtcacactcaacatggagaagtacaacttcctgggcatc
tccattgtgggccaaagcaatgagcggggagacgggggcatctacatcggctccatcatg
aagggtggggctgtggcggctgatggacgcattgagcctggggacatgcttttgcaggtg
aatgacatgaactttgagaacatgagcaatgatgatgcggtgcgggtgctgagagacatt
gtgcacaagccaggccccattgtgctgactgtggccaagtgctgggatccctctcctcag
gcttatttcactcttcctcgaaatgagcccatccagccaattgaccccgctgcctgggtc
tcacattctgctgcactgactggcaccttcccagcttatccaggctcctcctccatgagc
accattacatctgggtcctctttacctgatggttgtgagggccggggtctctccatccat
acagacatggcatctgtgactaaagccatggcagctccagagtctggactagaagttcgg
gaccgtatgtggctcaagatcaccattcctaatgcctttctcggctcagatgtggttgac
tggctctaccatcacgtggagggctttcctgagcggcgggaggcccgcaagtatgccagt
ggactgctaaaggcaggccttatccgacacacagtaaacaagatcaccttctctgagcag
tgctattacgtcttcggagacctcagtggtggctgtgagaattatttagtcaacctgtct
ttgaatgataatgatggctccagtggggcttcggatcaggacaccttggctcctctgcct
gggaccaccccctggcccctgctgcccaccttctcctaccagtacccagccccacaccca
tacagcccccagcccccaccctaccatgaactctcatcctatacctatggtggaggcagt
gctagcagccagcacagtgaagggagccggagcagtgggtccgcacgaagcgatgggggg
gcagggcgcacagggaggcctgaggagcgggcccctgagtccaagtccggcagcggcagt
gagtccgagccctccagccgggggggcagccttcggcgaggcggggatcctagtggcact
ggtgatgggggccctcccctttccaggagctcatcagggggtactcccagtcaccaagcc
cacccagggctccatccctatggtccaccccctggtatggccctcccctataaccccatg
atggtggtcatgatgcccccacctcctccagctgcccctccagtagtgcaacccccaggg
gcccctcccatcagagacctgggctcagtgcccccagagctgacagccagccgccaaagc
ttccacatggccatgggcaaccccagtgagttctttgtggatgttatgtag

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107510646
Entry
107510646         CDS       T06036                                 

Gene name
DVL1
Definition
(RefSeq) LOW QUALITY PROTEIN: segment polarity protein dishevelled homolog DVL-1
  KO
K02353  segment polarity protein dishevelled
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04150  mTOR signaling pathway
ray04310  Wnt signaling pathway
ray04330  Notch signaling pathway
ray04390  Hippo signaling pathway
ray04550  Signaling pathways regulating pluripotency of stem cells
ray04916  Melanogenesis
ray04934  Cushing syndrome
ray05010  Alzheimer disease
ray05022  Pathways of neurodegeneration - multiple diseases
ray05165  Human papillomavirus infection
ray05200  Pathways in cancer
ray05217  Basal cell carcinoma
ray05224  Breast cancer
ray05225  Hepatocellular carcinoma
ray05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    107510646 (DVL1)
   04330 Notch signaling pathway
    107510646 (DVL1)
   04390 Hippo signaling pathway
    107510646 (DVL1)
   04150 mTOR signaling pathway
    107510646 (DVL1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    107510646 (DVL1)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    107510646 (DVL1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107510646 (DVL1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    107510646 (DVL1)
   05226 Gastric cancer
    107510646 (DVL1)
   05217 Basal cell carcinoma
    107510646 (DVL1)
   05224 Breast cancer
    107510646 (DVL1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    107510646 (DVL1)
   05022 Pathways of neurodegeneration - multiple diseases
    107510646 (DVL1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    107510646 (DVL1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    107510646 (DVL1)
SSDB
Motif
Pfam: Dishevelled Dsh_C PDZ DIX DEP PDZ_6 Shufflon_N
Other DBs
NCBI-GeneID: 107510646
NCBI-ProteinID: XP_015999848
LinkDB
Position
Unknown
AA seq 757 aa
MAETKIIYHMDEEETPYLVKLPVAPERVTLADFKNVLSNRPVHAYKFFFKSMDQDFGSVG
RGPVRGRGCWHLSALGQGLGDPGAAPRRGVSTCLWVVDSGGQRRLQTCFNGPAWSPLGGP
ALAAWQWRALRRRGEAGHRAPRAPWVWPRGCRASPSHCSPPQLVLAEGAHSDAGSQATDG
HADLPPPLERMGGIGDSRPPSFHPNVASSREGMDNETGTESMVSHRRERARRRNREEAAR
TNGHPRGDRRRDLGLPPDSASTVLSSELESSSFIDXDEDGSTSRLSSSTEQSTSSRLIRK
HKRRRRKQRLRQTDRASSFSSSITDSTMSLNIITVTLNMERHHFLGISIVGQSNDRGDGG
IYIGSIMKGGAVAADGRIEPGDMLLQVNDVNFENMSNDDAVRVLREIVSQTGPISLTVAK
CWDPTPRSYFTIPRADPVRPIDPAAWLSHAAALAGARPLYELEEGPLTVKSDMGAVVRVM
QLPDSGLEIRDRMWLKITIANAVIGADVVDWLYTHVEGFKERREARRYASSMLKHGFLRH
TVNKVTFSEQCYYVFGDLCSSLAALTLHSGSSGASDQDMLAPLPHPAAPWPLGQGYPYQY
PGPPPCFPPAYQDPGFSYGSGSAGSQQSEGSKSSGSTRSAGGSSRRALGREKEHRGAGAG
GSGSESDHTAPSGVGGSGWRERPVSQLSRGSSPHSQASAAPGLPPLHPLTKAYSVVGGPP
GGPPVRELAAVPPELTGSRQSFQKAMGNPCEFFVDIM
NT seq 2274 nt   +upstreamnt  +downstreamnt
atggcggagaccaagatcatctatcacatggatgaggaggagacgccgtacctggtcaag
ctgcccgtggcgcctgagcgcgtcacgctggccgacttcaagaacgtgctcagcaaccgg
ccagtgcacgcctacaaattcttcttcaagtccatggaccaggacttcgggtcagtgggc
cgtgggcctgtgcgcgggcgcgggtgttggcacctgtcggcgcttgggcagggccttggg
gatcctggggccgcgccccggcgtggcgtgtccacctgtctgtgggtggtagattctgga
ggacagcgcaggctgcagacctgcttcaacggccctgcgtggtctcctttgggtggccct
gcactggcggcgtggcagtggcgggcactccggcggaggggggaggccggccaccgcgcc
ccgcgggccccgtgggtgtggcctaggggctgccgggcttccccgagccactgctctcct
ccgcagctggtcctggctgagggcgcccactcggatgcagggtctcaggccactgacgga
cacgcagacctgcccccgcctctggagcggatgggtggcatcggggactcccggcccccc
tctttccacccgaatgtggccagcagccgtgaagggatggacaatgagactggtaccgag
tccatggtcagccacaggcgggagcgagcccggcgccggaaccgtgaggaggctgcccgg
accaacgggcacccgaggggggaccggcggcgggacctggggctgccccccgacagtgcg
tccaccgtgctgagcagcgaactcgagtccagtagcttcatcgacncagacgaggatggc
agcacgagccggctgagcagctccacggagcagagcacctcctcccggctcatccggaag
cacaagcggcggcggcggaagcagcgcttgcggcagacggaccgcgcctcctccttcagc
agcagcatcacggactccaccatgtccctgaacatcatcaccgtcacgctcaacatggag
aggcaccacttcctgggcatcagcatcgtgggccagagcaacgaccggggtgacggcggc
atctacatcggctccatcatgaagggcggggccgtggctgcggacggccggatcgagccc
ggcgacatgctgctgcaggtgaacgacgtcaacttcgagaacatgagcaacgacgacgct
gtgcgggtgctgcgggagatcgtgtcgcagacggggcccatcagcctcacagtggccaag
tgctgggacccaacgccccggagctatttcaccatcccgagggctgacccggtgcggccc
atcgacccggccgcctggctgtcccacgcagcggcgctggccggagcccggcccctgtac
gagctggaggaggggccgctgacggtgaagagcgacatgggcgccgtggtccgggtcatg
cagctgccggactccggcctggagatccgcgaccggatgtggctcaagatcaccattgcc
aatgctgtcattggcgcggacgtggtggactggctgtacacgcacgtggaaggcttcaag
gagcgcagggaggcacgcaggtacgccagcagcatgctcaagcacggcttcctgaggcac
acggtcaacaaggtcaccttctccgagcagtgctactacgtcttcggggacctgtgcagc
agtctcgccgccctgaccctccacagcggctccagtggggcctcggaccaggacatgctg
gccccgctgccccacccggctgccccctggcccctgggccagggctacccctaccagtac
ccggggcccccgccctgcttcccgcccgcgtaccaggaccccggcttcagctacggcagc
ggcagtgctgggagtcagcagagtgaaggaagcaaaagcagcgggtccacccggagtgcg
ggcgggagcagccggcgggccctgggccgagagaaggagcatcgcggggctggagctgga
ggcagcggcagcgagtcagaccacacagccccgagtggagtcgggggcagcgggtggcgg
gagcgtccagtgagccagctcagtcgtggcagcagcccgcatagccaggcctcggcggcc
ccagggctccccccactgcatcccctgacgaaggcatactcagtggtgggcgggccgcct
ggggggcctcccgtccgggagctggccgctgtccccccagagctgacgggcagccgccag
tccttccagaaggccatggggaatccctgtgaattcttcgtcgacatcatgtga

DBGET integrated database retrieval system