KEGG   Rousettus aegyptiacus (Egyptian rousette): 107507294
Entry
107507294         CDS       T06036                                 

Gene name
JAK2
Definition
(RefSeq) tyrosine-protein kinase JAK2
  KO
K04447  Janus kinase 2 [EC:2.7.10.2]
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray01521  EGFR tyrosine kinase inhibitor resistance
ray04062  Chemokine signaling pathway
ray04151  PI3K-Akt signaling pathway
ray04217  Necroptosis
ray04550  Signaling pathways regulating pluripotency of stem cells
ray04630  JAK-STAT signaling pathway
ray04658  Th1 and Th2 cell differentiation
ray04659  Th17 cell differentiation
ray04725  Cholinergic synapse
ray04917  Prolactin signaling pathway
ray04920  Adipocytokine signaling pathway
ray04933  AGE-RAGE signaling pathway in diabetic complications
ray04935  Growth hormone synthesis, secretion and action
ray05140  Leishmaniasis
ray05145  Toxoplasmosis
ray05152  Tuberculosis
ray05161  Hepatitis B
ray05164  Influenza A
ray05167  Kaposi sarcoma-associated herpesvirus infection
ray05168  Herpes simplex virus 1 infection
ray05200  Pathways in cancer
ray05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    107507294 (JAK2)
   04151 PI3K-Akt signaling pathway
    107507294 (JAK2)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    107507294 (JAK2)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    107507294 (JAK2)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    107507294 (JAK2)
   04659 Th17 cell differentiation
    107507294 (JAK2)
   04062 Chemokine signaling pathway
    107507294 (JAK2)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    107507294 (JAK2)
   04917 Prolactin signaling pathway
    107507294 (JAK2)
   04935 Growth hormone synthesis, secretion and action
    107507294 (JAK2)
  09156 Nervous system
   04725 Cholinergic synapse
    107507294 (JAK2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107507294 (JAK2)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    107507294 (JAK2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    107507294 (JAK2)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    107507294 (JAK2)
  09172 Infectious disease: viral
   05161 Hepatitis B
    107507294 (JAK2)
   05164 Influenza A
    107507294 (JAK2)
   05168 Herpes simplex virus 1 infection
    107507294 (JAK2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    107507294 (JAK2)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    107507294 (JAK2)
   05140 Leishmaniasis
    107507294 (JAK2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    107507294 (JAK2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ray01001]
    107507294 (JAK2)
Enzymes [BR:ray01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     107507294 (JAK2)
Protein kinases [BR:ray01001]
 Non-receptor tyrosine kinases
  JAK family [OT]
   107507294 (JAK2)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase FERM_F2 FERM_F1 Jak1_Phl RIO1 Kinase-like APH
Other DBs
NCBI-GeneID: 107507294
NCBI-ProteinID: XP_015993839
LinkDB
Position
Unknown
AA seq 1132 aa
MEMACLTMTEMEGTSMSPVHQNGDIPGNANSVKQIDPVLQVYLYHSLGKTEGDYLKFPSG
EYVAEEICVAASKACGITPVYHNMFALMNETERMWYPPNHVFHVDDSARHNVLYRIRFYF
PYWYCNGSNRTYRHGISRGAEAPLLDDFVMSYLFAQWRHDFLHGWIKVPVTHETQEECLG
MAVLDMMRIAKEKDQTPLDIYSSVSYKTFLPKCVRAKIQEYHILTRKRIRYRFRRFIEQF
SHCKATARNLKLKYLINLETLQSAFYTEQFEVKEPGRGPSGEEIFATIIITGNGGIQWSR
GKHKESDTLTEQDLQLYCDFPDIIDVSIKQANQEGSNESRIVTIHKQDGKNLEVELNSLR
EALSFVSLIDGYYRLTADAHHYLCKEVAPPTVLENIQSNCHGPISMDFAISKLKKAGNQT
GLYVLRCNPKDFNKYFLTFAVERENVIEYKHCLITKNENGEYNLSGTKKNFSNLKDLLNC
YQMETVRSDNIIFQFTKCCPPKPKDKSNLLVFRTNGISDVPTSPTLLRHNNVNQMVFHKI
RNEDLIFNESLGQGTFTKIFKGVRREVGDYGQLHETEVLLKVLDKAHRNYSESFFEAASM
MSQLSHKHLVLNYGVCVCGEENILVQEFVKFGSLDTYLKKNKNSINILWKLEVAKQLAWA
MHFLEEKILIHGNVCAKNILLIREEDRKTGNPPFIKLSDPGISITVLPKDILQERIPWVP
PECIENPKILNLATDKWSFGTTLWEICSGGDKPLSALDSQRKLQFYEDRHQLPAPKWTEL
ANLINNCMDYEPDFRPSFRAIIRDLNSLFTPDYELLTENDMLPNMRIGALGFSGAFEDRD
PTQFEERHLKFLQQLGKGNFGSVEMCRYDPLQDNTGEVVAVKKLQHSTEEHLRDFEREIE
ILKSLQHDNIVKYKGVCYSAGRRNLRLIMEYLPYGSLRDYLQKHKDRIDHKKLLQYTSQI
CKGMEYLGTKRYIHRDLATRNILVENENRVKIGDFGLTKVLPQDKEYYKVKEPGESPIFW
YAPESLTESKFSVASDVWSFGVVLYELFTYIEKSKSPPAEFMRMIGNDKQGQMIVFHLIE
LLKNNGRLPRPDGCPDEIYVIMTECWNNNVNQRPSFRHLALRVDQIRDSMAG
NT seq 3399 nt   +upstreamnt  +downstreamnt
atggaaatggcttgccttacaatgacggaaatggaaggaacatccatgtctcctgtacat
cagaatggtgatattcctggaaatgccaattctgtgaagcaaatagacccagttctacag
gtgtatctttatcattcccttgggaaaactgaaggcgattacctgaagtttccaagtggg
gagtatgttgcagaagaaatttgtgttgctgcttctaaagcctgtggaatcacacctgtg
tatcataatatgtttgctttaatgaatgaaacagaaaggatgtggtatccacccaaccat
gtcttccatgtagatgactcagccagacataatgtactctacagaataagattttacttt
ccttactggtattgtaatggcagcaacagaacctatcgacatggaatatctcgaggtgct
gaagctcctcttcttgacgactttgtcatgtcatacctttttgctcagtggcgtcatgat
tttttgcatggatggataaaagtacctgtgactcatgaaacacaggaagaatgtcttggg
atggcagtgctagatatgatgagaatagctaaagaaaaggatcaaaccccactggacatc
tatagctctgtcagctacaagacattcttaccaaaatgtgttcgagcaaagatccaagaa
tatcatattttgacaaggaagagaataaggtacagatttcgcagatttattgagcaattc
agccattgcaaagccactgccagaaacttgaaacttaagtatcttataaatctggaaact
cttcagtctgcattctacacagagcaatttgaagtaaaagaacctggaagaggtccttca
ggtgaggagatttttgcaaccattataataactggaaacggtggaattcagtggtcaaga
gggaaacataaagaaagtgatacactgacagaacaggatttacagttatattgtgatttt
cctgatattattgatgtcagtattaagcaggcaaaccaggaaggctcaaatgaaagcaga
attgtcactatccataagcaagatggtaaaaatctggaagttgaacttaactcattaaga
gaagctttgtcttttgtgtcattaattgatggatattatagactaactgcagatgcacat
cattacctctgtaaagaagtagcacctccaacggtgcttgaaaatatacaaagcaactgt
catggcccaatttcaatggattttgccatcagtaaactgaagaaagcaggtaatcagact
ggactctatgtacttcgatgcaatcctaaggactttaataaatattttttgacttttgct
gtagagcgagaaaatgtcattgaatataagcattgtttgattacaaaaaatgaaaatgga
gaatacaacctaagcgggactaagaagaacttcagtaatcttaaagatcttttgaattgc
taccagatggaaactgttcgctcagacaatataattttccagtttacgaaatgctgtccc
ccaaagccaaaagataaatcaaaccttctagtctttagaaccaatggtatttctgatgta
ccaacctcaccaacattactgaggcataataatgtgaaccaaatggtttttcacaaaatt
agaaatgaagatttgatatttaatgaaagccttggccaaggcactttcacaaaaattttt
aaaggtgtaagaagagaagtgggagactatggtcaactgcatgaaacagaagtcctttta
aaagttctggataaagcacatagaaactattcagagtctttctttgaagcagcaagtatg
atgagccagctttctcacaagcatctggttttaaattatggagtatgtgtctgtggagag
gagaatattctggttcaggagtttgtgaaatttggatcattagacacatatttgaaaaag
aataaaaattctatcaatatattatggaaacttgaagtggctaaacaattggcatgggcc
atgcattttctagaagaaaaaatccttattcatgggaatgtgtgcgccaaaaatattcta
cttatcagagaagaagacaggaagacaggaaatcctcctttcatcaaacttagtgatccc
ggcattagtattacagttttgccaaaggacattcttcaagagagaataccatgggtacca
cctgaatgcattgaaaatcctaaaattctaaacttggcaacagacaaatggagttttggt
accactttgtgggaaatctgcagtggaggagataagcctctcagtgctttggattctcaa
agaaaactacagttttatgaagataggcaccagcttcctgcaccaaagtggacagaatta
gcaaatcttattaataattgtatggattatgaaccagattttagaccttctttcagagcc
attatacgagatcttaatagtttgtttactccagattatgaactattaacagaaaatgac
atgttaccaaatatgaggataggtgccctggggttttctggtgcttttgaagaccgagac
cctacacagtttgaagagagacacttgaaatttctgcagcaactgggcaagggtaatttt
gggagtgtggagatgtgccggtatgaccctctacaagacaatactggggaggtggtggct
gtgaaaaagcttcagcacagtactgaagagcacctcagagattttgaaagggaaattgaa
atccttaaatctctacagcatgacaacattgtaaagtacaagggagtgtgctacagtgct
ggccggcgtaacctaagattaattatggaatatttaccatatggaagtttacgagactat
cttcaaaagcataaagaccggatagatcataaaaaacttctgcagtacacatctcaaata
tgcaagggtatggagtatcttggtacaaaaaggtatatccacagggatctggcaacaagg
aatatattggtggagaatgaaaacagagttaaaattggagattttgggttaaccaaagtc
ttgccacaagacaaagaatactataaagtgaaagaacctggcgaaagtcccatattctgg
tatgctccagaatcactgacagagagcaagttttctgtggcctcagatgtttggagcttt
ggagtagttctgtatgaacttttcacatatattgagaagagtaaaagtcctccagcggaa
ttcatgcgtatgattggcaatgacaaacaagggcagatgattgtatttcatttgatagaa
ctcctgaagaataatggaagattaccaagaccagatggatgcccagatgagatttatgta
atcatgacagaatgctggaacaataatgtaaatcaacgcccctctttcagacacctcgct
cttcgagttgatcaaataagggacagcatggctggataa

DBGET integrated database retrieval system