KEGG   Rousettus aegyptiacus (Egyptian rousette): 107507351
Entry
107507351         CDS       T06036                                 

Gene name
CD38
Definition
(RefSeq) ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 1
  KO
K01242  ADP-ribosyl cyclase 1 [EC:3.2.2.6 2.4.99.20]
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray00760  Nicotinate and nicotinamide metabolism
ray01100  Metabolic pathways
ray04020  Calcium signaling pathway
ray04640  Hematopoietic cell lineage
ray04921  Oxytocin signaling pathway
ray04970  Salivary secretion
ray04972  Pancreatic secretion
Brite
KEGG Orthology (KO) [BR:ray00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    107507351 (CD38)
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    107507351 (CD38)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    107507351 (CD38)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    107507351 (CD38)
  09154 Digestive system
   04970 Salivary secretion
    107507351 (CD38)
   04972 Pancreatic secretion
    107507351 (CD38)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:ray04090]
    107507351 (CD38)
   00536 Glycosaminoglycan binding proteins [BR:ray00536]
    107507351 (CD38)
Enzymes [BR:ray01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.99  Transferring other glycosyl groups
    2.4.99.20  2'-phospho-ADP-ribosyl cyclase/2'-phospho-cyclic-ADP-ribose transferase
     107507351 (CD38)
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.6  ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase
     107507351 (CD38)
CD molecules [BR:ray04090]
 Proteins
  107507351 (CD38)
Glycosaminoglycan binding proteins [BR:ray00536]
 Hyaluronan
  Cell surface receptors
   107507351 (CD38)
SSDB
Motif
Pfam: Rib_hydrolayse
Other DBs
NCBI-GeneID: 107507351
NCBI-ProteinID: XP_015993901
LinkDB
Position
Unknown
AA seq 354 aa
MDHGLLPADPAVDHGLRPADPAVDPGPSRGSQMEEEEEEEGESWCTMSKKVKISVIVVLC
ALVLAAVALGVVFGVLKLHQTRQLKKWHGEGTTPHFHKKLLKRCYDYTQVLKPELRSAKD
CQKIVEAFMDAVLSKDPCRSTEEDYEPLMKLTEQTVPCDKTLFWSGTGELVHQYIKSQPE
MFTLENTLLGYMADGLKWCGDAGSSEMNYQSCPDWRKDCARTTMSIFWDTASKRFAGNAC
GVVQVMLNASRSPIFSENSTFGRVEIHNLNPGKVSILQASVVHNSEEEKSHSSWDSCEDS
SIKHLKLILRRRGVKFTCQSTSSSRFLPGKATAILPCAGIFPWVLMLIWGGDLW
NT seq 1065 nt   +upstreamnt  +downstreamnt
atggaccacggacttcttcccgccgaccccgcagtggaccacggacttcgtcccgccgac
cccgcagtggaccctggacccagccgcgggtcccagatggaggaagaggaggaggaggag
ggagaatcctggtgcacaatgtccaagaaagtcaagatctcggtcatcgtcgttctatgt
gccctggtcctcgcggccgtggccctcggagtggtgttcggagtcctgaagctgcaccag
acgcgccagctcaagaagtggcacggggagggcaccactccccattttcacaagaaactc
ctaaagcgatgctacgactacactcaagttttaaagcccgagctgagaagtgcgaaagac
tgccaaaagatagtggaggcgttcatggacgcggtgctgtcgaaggacccgtgcaggagc
acagaggaagactatgaacctctgatgaagttgacagagcaaactgtaccttgtgacaag
actctcttttggagtggcaccggtgagttggtgcaccagtacataaagagccagccagag
atgtttaccctggagaacacgctgctgggttacatggctgatggcctcaagtggtgtgga
gacgcaggctcctccgaaatgaactatcagtcttgcccagattggaggaaagactgtgcc
agaaccaccatgtccatcttctgggacaccgcgtctaaaaggtttgcaggaaacgcctgc
ggtgtagtccaggtgatgctcaatgcgtcccgcagccccatctttagtgaaaacagcacc
tttggacgtgtggaaatccataatttgaatccaggaaaggtttctatactacaagcctcg
gtggtgcataacagtgaagaagaaaaatctcacagctcttgggactcatgcgaggattcc
tccataaaacatctgaaactgattttacgcagaaggggtgttaaattcacctgccagagt
acctcaagtagtagatttcttcctggaaaagcaacggccatcctgccctgtgctggcatc
ttcccctgggtcttgatgctgatctggggtggtgacctatggtga

DBGET integrated database retrieval system