KEGG   Rousettus aegyptiacus (Egyptian rousette): 107507404
Entry
107507404         CDS       T06036                                 

Gene name
SCT
Definition
(RefSeq) secretin
  KO
K05263  secretin
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04080  Neuroactive ligand-receptor interaction
ray04972  Pancreatic secretion
ray04976  Bile secretion
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    107507404 (SCT)
 09150 Organismal Systems
  09154 Digestive system
   04972 Pancreatic secretion
    107507404 (SCT)
   04976 Bile secretion
    107507404 (SCT)
SSDB
Motif
Pfam: Hormone_2
Other DBs
NCBI-GeneID: 107507404
NCBI-ProteinID: XP_015993987
LinkDB
Position
Unknown
AA seq 127 aa
MAPRARLLLLLLLPPLLAGSAARPAPPRAPRHSDGMFTSELSRLRESARLHRLLQGLVGK
RSQQDPDYSTSWTKSAGGPLCLPRFHMLAPQAWVPLGQAWSPRFPPGLRSGLSASEPAGH
AGTHVRS
NT seq 384 nt   +upstreamnt  +downstreamnt
atggccccccgggcccggctgctgctgctgctgctgctgccgccgctgcttgcaggctcc
gccgcgcgccccgcgccccccagggccccgcgccactccgacggcatgttcaccagcgag
ctcagccgcctgcgggagagcgcccggctgcacaggctgctccagggcctggtgggcaag
cgcagccagcaggaccccgactacagcacctcctggaccaagtctgctgggggccccctc
tgcctaccgcggttccacatgctcgccccgcaggcctgggtgcccttgggccaggcctgg
tctccccggtttccgccaggactgaggtctgggctttcggcttcagagccagctggccat
gctgggacccacgtgaggtcctga

DBGET integrated database retrieval system