KEGG   Rousettus aegyptiacus (Egyptian rousette): 107507549
Entry
107507549         CDS       T06036                                 

Gene name
GUCY1A3
Definition
(RefSeq) guanylate cyclase soluble subunit alpha-3
  KO
K12318  guanylate cyclase soluble subunit alpha [EC:4.6.1.2]
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray00230  Purine metabolism
ray01100  Metabolic pathways
ray04022  cGMP-PKG signaling pathway
ray04270  Vascular smooth muscle contraction
ray04540  Gap junction
ray04611  Platelet activation
ray04713  Circadian entrainment
ray04730  Long-term depression
ray04921  Oxytocin signaling pathway
ray04924  Renin secretion
ray04970  Salivary secretion
Brite
KEGG Orthology (KO) [BR:ray00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    107507549 (GUCY1A3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04022 cGMP-PKG signaling pathway
    107507549 (GUCY1A3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    107507549 (GUCY1A3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    107507549 (GUCY1A3)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    107507549 (GUCY1A3)
   04924 Renin secretion
    107507549 (GUCY1A3)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    107507549 (GUCY1A3)
  09154 Digestive system
   04970 Salivary secretion
    107507549 (GUCY1A3)
  09156 Nervous system
   04730 Long-term depression
    107507549 (GUCY1A3)
  09159 Environmental adaptation
   04713 Circadian entrainment
    107507549 (GUCY1A3)
Enzymes [BR:ray01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.2  guanylate cyclase
     107507549 (GUCY1A3)
SSDB
Motif
Pfam: Guanylate_cyc HNOBA HNOB
Other DBs
NCBI-GeneID: 107507549
NCBI-ProteinID: XP_015994142
LinkDB
Position
Unknown
AA seq 690 aa
MFCTKLKDLKITGECPFSLLAPGQVPSEPAEEVAGSSESCKATLTICQDVPEKNVQGSIP
QRKTSRSRVYLHTLAESICKLIFPEFERLNLALQRTLAKHKIKDNRKFVEREDFENLITD
HSLAAGVPVEIIKESLGEELFKICYEEDEHILGVVGGTLKDFLNSFSTLLKQSSHCQEAE
KKGKLEDASILCLDKDNDFLNVYYFFPKRVTSLILPGVIKAAAHILYETEVEVSLMPSCF
LNDGGEFVNQPYLLYSVHVKSTKPSLSPGKPQSSLVIPASLFCKTFPFHFMFDRDMTILQ
VGNGIRRLMNRRDFQGKLNFEEYFEILTPKINPTFSGIMTMLNMQFVVRVRRWDNSVKKS
SRVMDLKGQMIYIIESSAILFLGSPCVDRLEDFTGRGLYLSDIPIHNALRDVVLIGEQAR
AQDGLKKRLGKLKSTLEQAHQALEEEKKKTVDLLCSIFPCEVAQQLWQGQVVQAKKFSNV
TMLFSDIVGFTAICSQCSPLQVITMLNALYTRFDQQCGELDVYKVETIGDAYCVAGGLHK
ESDTHAIQIALMALKMMELSDEVMSPHGEPIKMRIGLHSGSVFAGVVGVKMPRYCLFGNN
VTLANKFESCSVPRKINVSPTTYRLLKDCPGFVFTPRSREELPPNFPSDIPGICYFLEAY
QQGTNSKQWFQKKDVEYGNANFLGKASGID
NT seq 2073 nt   +upstreamnt  +downstreamnt
atgttctgtacgaagctgaaagatctcaagatcacaggagagtgtcccttttccttactg
gcaccagggcaggtccctagtgagccagcagaagaggtagctggaagctccgagagctgc
aaagccactctgaccatctgtcaggacgtccctgaaaagaatgtacaaggaagtattcct
caaagaaagaccagtcggagccgtgtctatctccacactttggcagagagcatttgcaaa
ctgattttcccagagtttgagcggctgaaccttgcacttcagagaacactggcaaaacac
aaaataaaagacaacaggaaatttgtggaaagagaagactttgaaaatttaattacagac
cactcacttgcagcaggggtcccagtggagatcatcaaagaatctctcggtgaagagctt
tttaaaatatgttatgaggaagacgaacacatcctgggtgtggttggaggaaccctcaaa
gattttttaaatagcttcagcacccttctgaaacagagcagccactgccaagaagcagaa
aagaagggcaagcttgaggatgcctccattctctgcctggataaagataacgatttccta
aatgtttactatttcttccctaagagggtcacgtccctgattcttcccggtgtgattaag
gcagctgctcacatcttgtacgaaaccgaagtagaagtgtcactaatgccttcctgtttc
ctcaacgatggcggcgagtttgttaatcagccctatttgttatactccgttcatgtcaaa
agcaccaaaccatccctgtcccctggcaaaccgcagtcctcgctggtcattcccgcatct
ctcttctgcaagacatttccattccatttcatgtttgacagagatatgacaattctgcaa
gttggcaatggcatcaggaggctgatgaacaggagagactttcaaggaaagctgaatttt
gaagagtattttgaaattctgactcccaaaatcaacccaacgtttagtgggatcatgact
atgttgaatatgcagtttgtagtccgagtgagaagatgggataactctgtgaagaaatct
tcaagggttatggatctcaaaggccaaatgatctacatcattgaatccagtgcgatcttg
ttcttggggtcaccctgtgtggacagattggaagattttacaggacgggggctctatctc
tcagatatcccaattcataatgctttgagggatgtggtcttgataggagaacaggccaga
gctcaagacgggctgaagaagaggctgggaaaactgaagtctacccttgagcaagctcac
caagccctggaggaggagaagaagaagacagttgatcttctttgctctatatttccctgc
gaggtggcgcagcagctgtggcaaggacaagttgtgcaagccaagaagttcagtaatgtc
accatgcttttctcagatattgttgggttcactgccatctgctcccaatgttcaccactg
caggtcatcaccatgctcaatgcactctacacgcgctttgaccagcagtgtggagagctg
gatgtctacaaggtggagaccatcggtgatgcatattgtgtggctgggggattacacaaa
gaaagtgatacccatgccattcagatagcactgatggccctgaagatgatggagctctct
gatgaagtcatgtctccccatggagaaccgatcaagatgcgaatcggactgcattctggg
tcagtttttgctggagttgttggagttaaaatgccccgttactgtctttttggaaacaac
gtcactttggctaacaaatttgagtcctgcagtgtaccacggaaaatcaatgtcagtcca
acaacttacagattactcaaagattgtcccggttttgtgtttacccctcgatcaagggag
gaacttccaccaaacttccctagtgatattcctggaatctgttattttctggaagcttat
caacaaggaacaaattcaaaacaatggttccaaaagaaagatgttgaatacggcaatgcc
aattttttaggcaaagcatcaggaatagattag

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107507550
Entry
107507550         CDS       T06036                                 

Gene name
GUCY1B3
Definition
(RefSeq) guanylate cyclase soluble subunit beta-1 isoform X1
  KO
K12319  guanylate cyclase soluble subunit beta [EC:4.6.1.2]
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray00230  Purine metabolism
ray01100  Metabolic pathways
ray04022  cGMP-PKG signaling pathway
ray04270  Vascular smooth muscle contraction
ray04540  Gap junction
ray04611  Platelet activation
ray04713  Circadian entrainment
ray04730  Long-term depression
ray04921  Oxytocin signaling pathway
ray04924  Renin secretion
ray04970  Salivary secretion
Brite
KEGG Orthology (KO) [BR:ray00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    107507550 (GUCY1B3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04022 cGMP-PKG signaling pathway
    107507550 (GUCY1B3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    107507550 (GUCY1B3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    107507550 (GUCY1B3)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    107507550 (GUCY1B3)
   04924 Renin secretion
    107507550 (GUCY1B3)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    107507550 (GUCY1B3)
  09154 Digestive system
   04970 Salivary secretion
    107507550 (GUCY1B3)
  09156 Nervous system
   04730 Long-term depression
    107507550 (GUCY1B3)
  09159 Environmental adaptation
   04713 Circadian entrainment
    107507550 (GUCY1B3)
Enzymes [BR:ray01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.2  guanylate cyclase
     107507550 (GUCY1B3)
SSDB
Motif
Pfam: Guanylate_cyc HNOB HNOBA 4_1_CTD
Other DBs
NCBI-GeneID: 107507550
NCBI-ProteinID: XP_015994149
LinkDB
Position
Unknown
AA seq 619 aa
MYGFVNHALELLVIRNYGLEVWEDIKKEAQLDEEGQFLVRIIYDDSKTYDLVAAASKVLN
LNAGEILQMFGKMFFVFCQESGYDTILRVLGSNVREFLQNLDALHDHLATIYPGMRAPSF
RCTDADKGKGLILHYYSEREGLQDIVIGIIKTVAQQIHGTEIDMKVIQQRNEECDHTQFL
IEEKESKEEDFYEDLDRFEENGTQESRISPYTFCKAFPFHIIFDRDLVVTQCGNAIYRVL
PQLQPGNCSLLSVFSLVRPHIDISFHGILSHINTVFVLRSKEGLLDVEKLECEDELTGTE
ISCLRLKGQMIYLPEADSILFLCSPSVMNLDDLTRRGLYLSDIPLHDATRDLVLLGEQFR
EEYKLTQELEILTDRLQLTLRALEDEKKKTDTLLYSVLPPSVANELRHKRPVPAKRYDNV
TILFSGIVGFNAFCSKHASGEGAMKIVNLLNDLYTRFDTLTDSRKNPFVYKVETVGDKYM
TVSGLPEPCIHHARSICHLALDMMEIAGQVQVDGESVQITIGIHTGEVVTGVIGQRMPRY
CLFGNTVNLTSRTETTGEKGKINVSEYTYRCLMTPENSDPQFHLEHRGPVSMKGKKEPMQ
VWFLSRKNTGTEESEQDDN
NT seq 1860 nt   +upstreamnt  +downstreamnt
atgtacggatttgtgaatcatgcgttagagctcctggtgatccgcaattatggcctggag
gtgtgggaagacatcaaaaaagaagcacaattagatgaagaaggacagtttcttgtcaga
ataatatatgatgattctaaaacttatgatttggttgctgctgcaagcaaagtcctcaat
ctcaatgctggagaaatcctccaaatgttcgggaagatgttttttgtcttttgtcaagaa
tctggttatgatacaatcttgcgtgtcctgggatctaatgtcagagaatttctacagaac
cttgatgctctgcatgaccaccttgctactatctacccaggtatgcgtgcaccttccttc
agatgcactgatgcagataagggcaaaggacttattctgcactactactcagagagagaa
ggacttcaggatattgtcattggaatcatcaaaacagtagctcaacaaatccatggcact
gagatagacatgaaggttattcagcaaagaaatgaagaatgtgatcatactcaattttta
attgaagaaaaagaatctaaagaagaggatttttatgaagatcttgacaggtttgaagaa
aatggcacccaggaatcacgcatcagcccatataccttctgcaaagcttttcctttccac
ataatatttgaccgagacctagtggtcactcaatgtggtaacgccatatacagagtgctt
ccccagctccagcctggcaattgcagccttttgtctgtcttctctctggtccgtcctcat
attgatattagtttccatgggatcctttcgcacatcaatacagtttttgtattgagaagc
aaggaaggattgttggatgtagagaaattagaatgcgaggatgaactgactgggactgag
atcagctgcttacgtctcaagggtcaaatgatctacttaccggaagcagatagcatactt
tttctgtgttcaccaagtgtgatgaatctggacgatttgacaaggagaggtctgtatcta
agtgacatccctttgcacgatgccacgcgtgatctcgttcttttgggagaacaattcaga
gaggaatacaaactgactcaagaactggaaatcctgacagacaggctgcagctcacttta
agagccctggaagatgaaaagaaaaagacagacacgttgctatactctgtccttcctccg
tctgttgctaatgagctgagacacaagcgtccagtgcctgctaaaagatatgacaatgtg
accatcctcttcagtggcattgtgggcttcaatgctttctgcagtaagcatgcatctgga
gaaggggccatgaagattgtaaaccttctcaacgacctttacaccagatttgacacattg
actgattcccggaaaaatccttttgtttataaggtggagactgtcggtgacaagtatatg
acagtgagtggtttaccagagccatgtatccaccatgcacgatccatttgccacctggcc
ctggacatgatggagattgctggccaggttcaagttgatggtgaatctgtacagataacg
atagggatacacactggagaggtggttacaggtgtcataggacagaggatgcctcggtat
tgtctttttggaaatacggtcaacctcacaagcagaacagaaaccactggagaaaaagga
aaaataaatgtgtctgaatatacatacagatgtcttatgacaccagaaaattcagatcca
cagttccatttggagcacagaggcccagtgtccatgaagggcaaaaaagaaccaatgcaa
gtttggtttctatccagaaaaaatacaggaacagaggaatcagagcaggatgataactga

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107509998
Entry
107509998         CDS       T06036                                 

Definition
(RefSeq) guanylate cyclase soluble subunit beta-2-like
  KO
K12319  guanylate cyclase soluble subunit beta [EC:4.6.1.2]
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray00230  Purine metabolism
ray01100  Metabolic pathways
ray04022  cGMP-PKG signaling pathway
ray04270  Vascular smooth muscle contraction
ray04540  Gap junction
ray04611  Platelet activation
ray04713  Circadian entrainment
ray04730  Long-term depression
ray04921  Oxytocin signaling pathway
ray04924  Renin secretion
ray04970  Salivary secretion
Brite
KEGG Orthology (KO) [BR:ray00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    107509998
 09130 Environmental Information Processing
  09132 Signal transduction
   04022 cGMP-PKG signaling pathway
    107509998
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    107509998
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    107509998
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    107509998
   04924 Renin secretion
    107509998
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    107509998
  09154 Digestive system
   04970 Salivary secretion
    107509998
  09156 Nervous system
   04730 Long-term depression
    107509998
  09159 Environmental adaptation
   04713 Circadian entrainment
    107509998
Enzymes [BR:ray01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.2  guanylate cyclase
     107509998
SSDB
Motif
Pfam: Guanylate_cyc HNOB HNOBA
Other DBs
NCBI-GeneID: 107509998
NCBI-ProteinID: XP_015998555
LinkDB
Position
Unknown
AA seq 738 aa
MYGFINTCLQSLVIEKFGEETWEKLKASAEVQDAFMTYTVYDDLITIKLVQEACKVLGVS
MEAILKLFGEYFFKFCKKSGYDRMLRTLGGNLTEFIENLDALHSYLALSYKEMNAPSFRL
ERGADRKMLLHYYSDRSGLCHIVPGIIEAVAKDFFDIDVAMNILDMNQETERTGKKEHVV
FLIVQKSHRQMRRAEPRLQDGQDLRRDEEALQAAFLRMKEKYLSVSVCPVKKSPWEIVRS
IVMFGKGHLLNTFVPIYPERLWIEEKTFCNAFPFHIVFDESLRVKQAGVNIQKYVPGLQT
QKIRLDEYFFIIHPQVTFNIFSIRKFINSQFVLKARREMMPEAWKSQPTLKLRGQMIWME
AVRCMIYLCSPKLRSLQELEERRMHLSDLAPHDTTRDLILLNQQRLAEMELSTQLERKKE
ELRILSKHLAIEKKKTETLLYAMLPEHVANQLKEGKKVAAGEFKTCTILFSDVVTFTNIC
AACEPIQIVNMLNSMYSKSDRLTSVHEVYKVETIGDAYMVVGGVPVPIGSHAQRVANFAL
GMKISAKEVMNPVTGEPIQIRVGIHTGPVLAGVVGDKMPRYCLFGDTVNTASRMESHGLP
NKVHLSPTAYRALENQGFEIIERGEIEVKGKGKMTTYFLIQNLNASEDEIMGRPQALLHD
KEASTQGSQDSKTVAVMRYADSLPKIDAADASDKLTPEGSPVAEPDSVEAADRQRSLDET
EAHPLPNNTLPSGFCALL
NT seq 2217 nt   +upstreamnt  +downstreamnt
atgtatggatttatcaacacctgtctgcaatctcttgtgatagagaaatttggtgaagag
acatgggaaaaactgaaagcttctgctgaagtgcaagatgccttcatgacatacacagta
tatgacgacctcatcaccattaagctcgtccaagaggcatgcaaggttctgggtgtctcc
atggaagccatcttgaaactctttggagaatacttcttcaaattctgtaagaagtctggc
tatgacaggatgttacgaacactgggaggaaatctcacggaatttattgaaaacctagat
gccctccacagttacctcgcactctcttataaggagatgaatgcaccatcgtttcgtttg
gagagaggagcagacagaaaaatgcttctccattactactctgatagaagtggtctgtgc
cacattgtaccagggatcattgaggctgtggccaaagacttcttcgacattgatgtggcc
atgaatatccttgacatgaatcaggaaacggagaggacagggaagaaggaacatgttgtg
tttctgattgtgcagaagtctcacagacagatgagaagggcagagcctaggttacaagat
ggtcaggacctccggagagatgaggaggccctccaggcagctttccttaggatgaaggag
aaatatctgagtgtctctgtttgtcctgtgaagaagtccccttgggaaattgtgagaagt
atagtcatgtttggaaaagggcatctcctgaacacctttgtgccaatttatcctgaacgg
ctctggattgaagagaagacattctgcaatgcttttcctttccacattgtatttgatgaa
tcactgagggtcaagcaagccggagtgaatattcagaagtatgtcccaggactccaaacc
cagaagattcgattagatgagtatttcttcatcattcatccccaagttaccttcaacatt
ttcagcatccgcaaatttatcaacagtcaatttgtcctgaaggcccggagagaaatgatg
cctgaagcgtggaaaagtcaacccacactcaaactccgaggccagatgatctggatggag
gctgtgcgctgcatgatatacctgtgctccccaaagctccgcagcctgcaggagctggag
gagcgccggatgcacctttctgacctcgccccccatgacacgaccagggatctcatcctg
ctgaaccagcagcggctggctgagatggagctgtccacccagctggagaggaagaaggag
gagctgcggatcctctccaagcacttggccatagaaaagaagaaaacagagaccttgctt
tatgccatgctgcctgaacatgtggccaaccagctgaaggaaggcaaaaaggtggctgca
ggagaatttaaaacctgcacaatcctttttagtgatgtggtgacatttactaacatctgt
gctgcctgcgaacctatccaaatagtgaatatgctaaattcaatgtactccaagtctgac
agattaaccagtgtccacgaggtctacaaagtggaaacaataggagatgcttatatggtg
gtggggggtgtaccagtgcctatcggaagccatgcacaaagagtggctaattttgccttg
gggatgaaaatttctgcaaaagaagtgatgaatcctgttactggagagcccatccagatc
agagtggggattcatactggaccagtcttagcaggtgttgtgggggacaagatgccacgg
tactgcttgtttggtgacaccgtgaacacagcttctaggatggaaagtcatgggcttccc
aacaaagtacacctgagccccacggcttacagagccctggaaaaccaaggatttgaaatt
attgagagaggcgaaattgaagtgaaagggaaagggaaaatgaccacatactttctgatc
cagaacttgaatgcctcagaggatgagataatggggagacctcaagctctgcttcatgac
aaagaagcaagtactcaaggaagtcaagacagcaaaactgttgctgtcatgagatatgca
gacagcctccccaaaattgatgcagcagatgcttctgacaaattaacacctgaagggagt
ccggtggcggaacctgactctgtggaggcagctgacagacaacggtctttggatgagaca
gaggcacatcccttgcctaacaacaccctgccctctggtttctgtgcgctgctgtag

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107518221
Entry
107518221         CDS       T06036                                 

Gene name
GUCY1A2
Definition
(RefSeq) guanylate cyclase soluble subunit alpha-2
  KO
K12318  guanylate cyclase soluble subunit alpha [EC:4.6.1.2]
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray00230  Purine metabolism
ray01100  Metabolic pathways
ray04022  cGMP-PKG signaling pathway
ray04270  Vascular smooth muscle contraction
ray04540  Gap junction
ray04611  Platelet activation
ray04713  Circadian entrainment
ray04730  Long-term depression
ray04921  Oxytocin signaling pathway
ray04924  Renin secretion
ray04970  Salivary secretion
Brite
KEGG Orthology (KO) [BR:ray00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    107518221 (GUCY1A2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04022 cGMP-PKG signaling pathway
    107518221 (GUCY1A2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    107518221 (GUCY1A2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    107518221 (GUCY1A2)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    107518221 (GUCY1A2)
   04924 Renin secretion
    107518221 (GUCY1A2)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    107518221 (GUCY1A2)
  09154 Digestive system
   04970 Salivary secretion
    107518221 (GUCY1A2)
  09156 Nervous system
   04730 Long-term depression
    107518221 (GUCY1A2)
  09159 Environmental adaptation
   04713 Circadian entrainment
    107518221 (GUCY1A2)
Enzymes [BR:ray01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.2  guanylate cyclase
     107518221 (GUCY1A2)
SSDB
Motif
Pfam: HNOB HNOBA
Other DBs
NCBI-GeneID: 107518221
NCBI-ProteinID: XP_016015171
LinkDB
Position
Unknown
AA seq 434 aa
MGGGAHKGRRREAGSKARGAGGGGGERERGRDRRAGGRISDAPSLKKPPPPPAAYQSRGG
GRVPPVQALLGRQPEPAGAARARRGRRHGRGQEGAAPEAGQPGLAGRERRPPDGASPQTI
QQTLKRTLQYYEHQVIGYRDAEKNFHNISNRCSYADHSNKEEIEDVSGILQCTANILGLK
FEEIQEKFGEEFFNICFDENERVLRAVGGTLQDFFNGFDALLEHIRTSFGKQATLESPSF
LCKELPEGTLMLHYFHPHHTVGFAMLGMIKAAGKKIYRLDVEVEQVANEKLCSDSSNSGN
CSCLTFLIKECENTNITKNLPQGTSQVPADLRISINTFCRAFPFHLMFDPHMLVLQLGEG
LRKQLRCDTHKVLKFEDCFEIVSPKVNATFERVLLRLSTPFVIRTKPEASGTENKDKVSD
RELFEMGDGNQKSA
NT seq 1305 nt   +upstreamnt  +downstreamnt
atgggggggggtgcgcataaagggagacggagggaggcgggcagcaaggcgagaggggcg
ggaggaggggggggagagagagaaagagggcgagataggcgcgcgggcggcagaatctct
gacgcgccgagcctgaaaaagccgccgccgccgcccgcagcataccagtcccgaggagga
gggcgagtgccccctgtccaggctctgctgggacggcagccggagcccgccggggccgcc
cgagcccggcgcggccgccgccacggccggggccaggagggcgcagcgccggaggcgggt
caacctggactcgcggggcgagagcgtcggccgcctgacggcgcctcgcctcagacgatt
cagcaaactctcaagaggacattgcagtattatgagcatcaagttattggttatagggat
gcagaaaagaatttccacaatatctctaacagatgctcctatgcagaccattccaacaaa
gaggaaattgaagacgtctcaggaattcttcagtgtactgctaatatactcggtttgaag
tttgaggaaattcaagaaaaatttggtgaggagttctttaatatttgcttcgatgagaat
gagagagtccttcgagctgtaggtggcacattgcaggacttttttaatggctttgatgct
ttgttggaacacattagaacttcttttggaaaacaggccactctggagtcaccatcattc
ctatgcaaagagctccctgaaggtactcttatgctccactacttccaccctcaccatact
gtggggtttgcaatgctggggatgattaaggctgcaggaaagaagatctatcggctggat
gtggaagtggaacaggttgcaaatgagaaactgtgctctgatagttcaaactcaggcaac
tgtagctgtcttacgttccttatcaaagaatgtgaaaatactaacatcacgaaaaacctt
ccacaaggaacctcccaagttcctgcggacctcagaattagcatcaacaccttctgcaga
gccttccctttccacttgatgttcgatccccacatgttagtccttcagctgggggaaggc
ttacggaagcagctccgatgtgacactcacaaagtgctcaagtttgaggactgcttcgag
attgtttctccaaaggttaatgccacctttgaaagggtgctgctgcgactgtctacccca
tttgtgattaggaccaagcctgaggcttctggtactgaaaataaagacaaggtaagtgac
cgtgaactgtttgagatgggtgacgggaaccagaagagtgcataa

DBGET integrated database retrieval system